SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014609 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014609
Domain Number 1 Region: 423-579
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-33
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 637-788
Classification Level Classification E-value
Superfamily Spectrin repeat 5.28e-32
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 1663-1812
Classification Level Classification E-value
Superfamily Spectrin repeat 2.29e-31
Family Spectrin repeat 0.0000217
Further Details:      
 
Domain Number 4 Region: 317-467
Classification Level Classification E-value
Superfamily Spectrin repeat 2.61e-31
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 754-895
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-30
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 6 Region: 120-260
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-29
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 1450-1604
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-29
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 8 Region: 1344-1497
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-29
Family Spectrin repeat 0.0001
Further Details:      
 
Domain Number 9 Region: 1242-1389
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-28
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 10 Region: 1774-1925
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-27
Family Spectrin repeat 0.0000684
Further Details:      
 
Domain Number 11 Region: 18-153
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-25
Family Spectrin repeat 0.00000113
Further Details:      
 
Domain Number 12 Region: 2037-2150
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-24
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 13 Region: 977-1057
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-20
Family SH3-domain 0.00014
Further Details:      
 
Domain Number 14 Region: 1895-2030
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-17
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 15 Region: 2156-2263
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 16 Region: 899-963,1041-1078
Classification Level Classification E-value
Superfamily Spectrin repeat 1.53e-16
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 17 Region: 2256-2383
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000676
Family EF-hand modules in multidomain proteins 0.043
Further Details:      
 
Domain Number 18 Region: 1087-1181
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000119
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014609   Gene: ENSMLUG00000016009   Transcript: ENSMLUT00000016036
Sequence length 2418
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429957:905060:974414:-1 gene:ENSMLUG00000016009 transcript:ENSMLUT00000016036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHLPKETAMESGGPKVLETAEEIQERRQEVLARYARFKDLVAERGQKLEDSYHYQVFRRD
ADDLEKWILEKLKIAGDKSYEDPTNIQGKYQKHESFEAEVQAKSRVIPELEEIRKVRFAE
GHFAHEDTKVHLEELRRLWDLLVELTQEKGAFLRQALRLQQYLQECADILEWIGDKEAIV
TSVELGEDWERTEVLHKKFEEFQVDLAARKGRVDGVNEYANKCAEENHPELPLIKSKQDE
VNAAWERLHGLALQRRKTLSNAADLQRFKRDVTEAIQWIKEKEPQLTSEDYGKDLVSSEA
LFHSHKGLERNLAVMDDKVKELCAKADKLKLSHPADAPQIQQMKEDLVSNWEHIRALATS
RYAKLQASFWYQRFLSDYDELSGWMTEKTALINADELPTDVAGGEALLDRHQQHKHEIDS
YDDRFQSADETGHALLDVNHEASSEILEKMTKLANNWAALLDLWDKRQHQYEQCLDLHLF
YRDSEQVDSWMSRQEAFLENEDLGNSLGAVETLLQKHDDFEEAFTAQEEKITTLDKTATK
LIDNDHYDSENIASIRDGLLARRDALRERAATRRRLLEDSLLLQQLYQDSDDLKNWINKK
KKLADDEDYKDTQNLKSRVQKQQVFEEELAANKILLSNLEKTGQEMIEGGHYAADSVAAR
LAEVASLWEQLLESTAQKGTQLFEANQQLQFENNAEDLKRWLEEVEWQATSEDYGKGLAD
VQNLLKKHNFLESGVAARQEQVDTITDLATYFEETGHPDAGDIRARQESLVSRFEALKEP
LATRKKKLIDILRLQQICRDTEDEEAWIQETEPSAASTLLGKDLITSKNLLNRHQVIQAD
IASHEPRIRVITDRGNKMVEEGHFAAEDVASRVKSLNENMESLQGRAARRQNDLEANVQF
QQYLADLHEAEAWIREKEPIVDNTNYGADEEAAGVLLKKHEAFLVDLNAFGNSMQALRDQ
AEACQQQQAAPVEGAAREERVVALYDFQARSNREVTMKKDDVLTLLSSINKDWWKVEHED
HQGFVPAVYVRKLAHDEFPTLPQRWREEPGSITQRQQQIEDQYHSLLDRAEQRRRGLLQR
YNEFLLAYEAGDMLDWIREKKAENTGIELDDVWELQKKFDEFQTDLKTNEPRLRDINKVA
DDLLFEGLLTPEGTHIRQELNTRWGSLQRLAEEQRQLLGSAHAVQMFHRKREADDVKEQI
EKKCQALSAADPGSDLFSVQALQRQHEGFERDLAPLGEKVVILGETAERLSESHPDATDD
LQKQRTELNEAWDDLLGLTKDRKENLSEAQKFYLFLQQGQDLQNWISGMDGMVSSQEMAE
DLTGTEILIERHQEHHADMEAEAPTFQALEDFGAELIGSGHRDSPEIEKKLQAVRQERDD
LEKAWEQREKMLNQCLEYQLFQGNCDQAESWMVARENFLRSDDKGSLDSLEALMKKRDDL
DKAITAQEKKITELEHFAERLIADDHYAKEEIAARLQRVLDRWKALKALLIAERTKLGNY
ADLKQFYRDLEDLEEWISEMLPTACDESYKDPTNIQRKYLKHQTFENEVYGRAEQVEGVI
NLGNSLIEQRACDGNEETMKGQLEELEKHWDYLLERTIDKGQKLNEASRQQRFNTGIRDF
EFWLSEAETLLAMKDQARDLASAGNLLKKHQLLETEMLARNDALKDLNELAADLLSSGTF
NADQIVEKRDNVNKRFLDVQNLAAAHHEKLKETYALFQFFQDLDDEEAWIEEKLVRVRSQ
DQGRDLQGVQNLLKKHRRLEGELMAHEPAIQNVLDMAEGLGDKAAVGREEIQERLAQFVQ
HWEQLKELTKARGLQLEESLEYLQFMENAEEEEAWINEKEAMVARGDSGDTLAATQSLLK
KHEALDNDFAVHEARVQNVCAQGEGILSKEEIRHKEKISAKIEALNAKTPSLAQAIASWK
VQLEDDRAFQEFNWKADVAEAWIAEKERSLKINGNGADLTAFLTLLAKQDTLDASVQSFQ
QERLGKITDLKDQLVAAQHSQSKAIEERHAALLRRWEQLLEACAAHRQKLLEKQLPLQKA
EELFMEFAHKASAFNHWCENAEEDLSENVHCVSLNEIRQLQKDHEAFLASLAKAQEDLNY
LRELDQQIKSLNVPSSPYTWLTMEVLERMWNHLPDIIKEREQELQKEEERQVKNFEMCQE
FEQNASAFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQLMKRQLTKIEDLGD
NLEEALVLDIKYSTIGLAQQWDQLYQLGMRMQHNLEQQIQAKDTIGVSEETLKEFSTTYK
HFDENLTGRLSHKDFRSCLRGLNYYLPMVEEDEPEPKFEKFLDVVDPGRKGYVSLEEYTS
FLIDKESENIKTSDEIENAFQALAEGKNYITKEDMKQALTPEQVSFCASHMQQYVDPRGR
SHPAGYDYVGFTNSFFGN
Download sequence
Identical sequences G1PTP6
ENSMLUP00000014609 ENSMLUP00000014609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]