SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014622 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014622
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-46
Family Phosphotyrosine-binding domain (PTB) 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014622   Gene: ENSMLUG00000016048   Transcript: ENSMLUT00000016051
Sequence length 293
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430150:1014406:1019133:1 gene:ENSMLUG00000016048 transcript:ENSMLUT00000016051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAPNKALASILGKSNLR
FAGMSIAVSISTDGLNLSVPATRQIIANHHMQSISFASGGDTDMTDYVAYVAKDPINQRA
CHILECCEGLAQSVISTVGQAFELRFKQYLHSPPKVVVPPERLTGLEESAWGDEEDMEHN
YYNSIPGKEPPLGGLVDSRLTLTQPCALGALGAVSQGASPPRRDTHGLHWELGPSASPAP
PGDGYVQADAQGPRDYEDHLYVNTQGLDASEPLQPEDSPKKDLFDMRMWGQAI
Download sequence
Identical sequences G1PTQ4
ENSMLUP00000014622 ENSMLUP00000014622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]