SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014630 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014630
Domain Number 1 Region: 963-1238
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.25e-55
Family Patatin 0.049
Further Details:      
 
Domain Number 2 Region: 178-316
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-24
Family cAMP-binding domain 0.012
Further Details:      
 
Domain Number 3 Region: 511-630
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.37e-19
Family cAMP-binding domain 0.005
Further Details:      
 
Domain Number 4 Region: 627-701
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000393
Family cAMP-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014630   Gene: ENSMLUG00000016045   Transcript: ENSMLUT00000016061
Sequence length 1363
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430382:12595:31858:-1 gene:ENSMLUG00000016045 transcript:ENSMLUT00000016061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQKTGAAVNVSGVDVAQWDGVQDVLAPGGSVGRVCDAQQVPFVPQVLGVMIGAGVAVL
VTVLILLLVRSFRVPKTPAPEGPRYRFRKRDKVLFYGRKIMRKVSQSTSSLVDTSVSAAS
RPRMKKKLKMLNIAKKILRIQKETPTLQRKEPPPAVLEADLTEGDLANSHLPSEVLYMLK
NVRVLGHFEKPLFLELCRHMIFQRLSQGDYVFRPGQPDASIYVVQDGLLELCLPGPDGKE
CVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKYPES
LVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPVRTSPVRGSKRVG
STSATEEPREAPGRPPDPTGAPLPGPAGDLVKPTSLEAPSAPLLSRCISMPVDISGLQGG
PRSDFDMAYERGRISVSLQEEASAGPQVVPVRTPTQEPREQPAGACEYSYCEDESATGGC
PFGPYQGRQTSSIFEAAKRELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSLHF
VLWGCLHVYQRMIDKAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISKSD
FYEIIRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQGDRSDCTYIVLN
GRLRSVIQRGSGKKELVGEYGRGDLVGVIRQLPRMPRAFVLWPVCSAVRASVPKGAVGQL
RDTGQGFLRRRRRAPSRDTAAQQISSFGVSAGSGLGVPPHSELTNPASNLATVAVLPVCA
EVPMVAFTLELQHALQAIGPTLLLNSDIIRARLGASALDSIQEFRLSGWLAQQEDTHRIV
LYQTDSSLTPWTVRCLRQADCILIVGLGDQEPTLGQLEQMLENTAVRALKQLVLLHREEG
PGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSRRVDRHSDFSRLAR
VLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSASRT
KQRAREWAKSMTSVLEPMLDLTYPATSMFTGSAFNRSIHRVFQDKQIEDLWLPYFNVTTD
ITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLPADIARSMGAK
TVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWTDKIKVPDMAEIQSRLAYVSCVRQL
EVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGGWSRGDVIEKMLTDRRS
ADLIESRRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDC
SRDEGGSPEGASPSTASEMEEDKTVLRHRRCLPQDASSSPADT
Download sequence
Identical sequences G1PTR1
ENSMLUP00000014630 ENSMLUP00000014630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]