SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014672 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014672
Domain Number 1 Region: 367-612
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.64e-18
Family Nucleotide and nucleoside kinases 0.011
Further Details:      
 
Domain Number 2 Region: 76-347
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000000802
Family Tyrosine-dependent oxidoreductases 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014672
Domain Number - Region: 682-718
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0233
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014672   Gene: ENSMLUG00000016099   Transcript: ENSMLUT00000016104
Sequence length 724
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429995:1869661:1907475:-1 gene:ENSMLUG00000016099 transcript:ENSMLUT00000016104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEEDIVRTEKVIRVQRVFINLLDSYSSGNIGKFLSNCVVGASLEEMTEEEEEDDESKS
AIPDASSSKLKEGTFQIVGTLSTSGKPSPDFALETYSDISREELLMRLLECDVIIYNITE
SPKQAEEALWAVSALNEEVNHFEKRKVFILVSTVMTWARSKPLDPEDSEVPFTEEDYRRR
KHHPNFLDHINAEKMVLKFGKNVKKFATYVVATGLQYGAEGGILHFFFKLAWLGEVPALP
VFGDGTNVIPAIHVLDLAGVIQNVIDHVPKVHYLVAVDDSVQTLEDLVKCISRNTGPGKV
QKVLKENAFLSKDLTQDSIDHLLLNLRMEALYVKENFNIRWVSQTGFVENIGNVLREYKQ
SRGLLPIKVCILGPPAVGKSSVAEVLAKYYKIHHIKLKDVIAEAIAKLEAIVAPKFGGEG
GEEDEEEEEEEENVEDAQELLDGIKESMEQNAVGRLEDQYVIRFVKEKLKSMPCRNQGYI
LDGFPKTYDQAKDLFNKDEEEEEEEIRGKMLPFDKLIIPEFVCALDGSDEFLKLRVMNLP
ESVVVGTHYSQDQFLRSLSNFRDLNTEDETVFNYFDELEIHPIHIDVGKIEDPHNRLTIK
RLIKEIGEPRNYGLTDEEKAEEERKAAEERMAREAMVEAEREHKEAVEMAEKIARWEEWN
RRLEEVKREETELLEAQSAPLRNYLMTYVMPTLMQGLNECCKVRPEDPVDFLAEYLFKHN
PATL
Download sequence
Identical sequences G1PTU7
ENSMLUP00000014672 ENSMLUP00000014672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]