SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014701 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014701
Domain Number 1 Region: 299-441
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-39
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 195-300
Classification Level Classification E-value
Superfamily Second domain of FERM 1.03e-36
Family Second domain of FERM 0.00000297
Further Details:      
 
Domain Number 3 Region: 114-194
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.89e-27
Family First domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014701   Gene: ENSMLUG00000016125   Transcript: ENSMLUT00000016135
Sequence length 1097
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429825:1907811:1990514:-1 gene:ENSMLUG00000016125 transcript:ENSMLUT00000016135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKPEQEAEPARCMKICALRGSGGSLSPACPLSQSRSLLSVLSSLSAHVPL
ATRTMVTDREREFAAGAAKQLEYQQLEDDKLSQKSYSSKLSRSPLKIVKKPKSMQCKVIL
LDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDTENQKNWLDPAKEIKKQIR
NGAWQFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSE
LGDYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMY
GVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEF
EQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQT
RRASALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEE
ERDEEEDRRKKAEEATAAAAVRPEGKSPGLGTDSCSLSPPSAHCPPASPTELRRRCKEND
HQPPGCKPSKDTVPVHGEPSVDSDGKGKPYLADQDVAFSYKQQTGKGATLFSFSLQLPGS
FPSLLDDDGYLSFPNLSETNLLPQSLQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALT
LSFPLALCLCYLEPKAASLSASLDNDPSDSSEEETDSERTDTAADGETTATESDQEEDAE
LKAQELDKTQDDLMKHQTNISELKRTFLETSTDTAIMNEWEKRLSTSPVRLAARQEDAPM
IEPLVPEETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSSSQSWVQKTETKTESSET
ETETTQPPQPLSMEKVVQETVVVEERRVMNVHASGDASYAAGDDADAAAQAASAGASSVK
GKEGSALTEGAKEEKGEVADKAVLEQEEMATASHEPEEEQSATIHVSETLEQKPHFESST
VKTETISFGSVSPGGATLEISTKELPVVHTETKTITYESSEVDPSADLEPGVLMSAQTIT
SETTCSTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVT
KVVVHKETEITPEDGED
Download sequence
Identical sequences G1PTX2
ENSMLUP00000014701 ENSMLUP00000014701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]