SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014706 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014706
Domain Number 1 Region: 5-86
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-22
Family PDZ domain 0.00071
Further Details:      
 
Domain Number 2 Region: 282-311
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000034
Family LIM domain 0.0027
Further Details:      
 
Domain Number 3 Region: 252-281
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000428
Family LIM domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014706   Gene: ENSMLUG00000016139   Transcript: ENSMLUT00000016142
Sequence length 332
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430067:603232:617774:1 gene:ENSMLUG00000016139 transcript:ENSMLUT00000016142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELM
THLEAQNRIKGCHDHLTLSVSRPEGRSWPSAPEDSKAQAHRIHIDPETQDGSPMTSRRPS
ATGIGPEDGRPDLGSPYGQSPLLSVPHNGSSSEATLLAQMSTMHVSPPHSTDPGRGLPRS
RDCGAHRGSEVYRMLQEPAEPLAPAEPKQSGSFRYLQGMLEAGEGGERQGPGSPRNLKPT
AGKLGAPLSGLKGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDE
RLYCENHAKARVKPPEGYDVVAVYPNAKVELV
Download sequence
Identical sequences G1PTX7
ENSMLUP00000014706 ENSMLUP00000014706 XP_006100208.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]