SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014748 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014748
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-27
Family SH2 domain 0.00000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014748   Gene: ENSMLUG00000016182   Transcript: ENSMLUT00000016187
Sequence length 346
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430047:881313:888550:1 gene:ENSMLUG00000016182 transcript:ENSMLUT00000016187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEARKLPPPLPPRLYWFVQTQLGQLVQGGVPSWFHGAISRQDAENLLESKPLGSFLIRV
SHSHVGYTLSYKAQNCCRHFMVKLLDDGSVLIPGEEKAHASLDALITFHQQQPMRPHGEL
LKQPCPQKDPANVDYEDLFLCYNALAEEAASPPVAAPKEASAKPVALHWQKERMLSAAVD
RAPAEAAASSCPPKAPLEEACQKLWRNLKTLPQTGKKVHQQLKSHLATVSLSSLRDPERS
EVTRGPATAADDAVPENVYAEPFVATAPSSPSQPRARKDRGDSSKKASRSVSWSEVTPRT
RGWHQAIARALSSQVSKSEPKGLAEPQEDCVPEEYRPPPPFAPGYC
Download sequence
Identical sequences G1PU07
ENSMLUP00000020372 ENSMLUP00000014748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]