SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014752 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014752
Domain Number 1 Region: 2141-2441
Classification Level Classification E-value
Superfamily BEACH domain 6.67e-130
Family BEACH domain 0.0000000000162
Further Details:      
 
Domain Number 2 Region: 2556-2813
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.11e-35
Family WD40-repeat 0.0073
Further Details:      
 
Domain Number 3 Region: 114-299
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-31
Family Clostridium neurotoxins, the second last domain 0.013
Further Details:      
 
Domain Number 4 Region: 2030-2136
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-29
Family PreBEACH PH-like domain 0.00000251
Further Details:      
 
Domain Number 5 Region: 414-498,577-868
Classification Level Classification E-value
Superfamily ARM repeat 1.03e-19
Family Mo25 protein 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014752   Gene: ENSMLUG00000016161   Transcript: ENSMLUT00000016192
Sequence length 2828
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:18908161:19407678:-1 gene:ENSMLUG00000016161 transcript:ENSMLUT00000016192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVGGQFDLEMNFIIQEGESIICMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQICTEVG
LVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGQWPPHAGKLLS
VLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDKP
YLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWK
NSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSEALN
AAQIFAIYQLGLGYKGTFKFKTESDLFLAEHHKLLLYDGKLSSAIAFTYNPRATDAQLCL
ESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGIQVLFPLFAQLDYRQYLSEE
VDLTICSTLLSFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSSKSHVSRAVLELCLAFS
KYLSNLQNGMPLLKQLCDHILLNPAIWIHTPAKVQLTLYTYLSTEFIGTVNIYNTIRRVG
TVLLIMHTLKYYYWAVNPQDRSGIIPKGLDGPRPTPKEILSLRAFLLMFIKQLVMRDSGV
KEDELQAILNYLLTMHEDDNLMDVLQLLVALMSEHPNSMIPAFDQRNGLRVIYKLLASTS
EGIRVQALKAIGYFLKHLAPKRKAEVMLGHGLFSLLAERLLLHTNLITMTTYNVLFEILI
EQICTQVIRKQHPDPDSSVKIQNPQILKIIATLLRNSPQCSESMEVRRAFLSDMIKLFNN
SRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYHAVKYEWGGWRVW
VDTLSITHSKVTFEIHKENLANIFREYQGNVDDIGQCSSSSVQAVSGISGDVNVSGGSQQ
SDMKDSPVSPHVTKNSDGKSSIEKTSSSDSASNIELQTYNTANEEMKTGQGNEELLDEVP
LEKTPINDIANAGDLEVPSDTVEVGTIFSNTLKTGAKDMTVSEVTASVSSPSEEDASEAP
ELLDKSIGEEEDDEDYVELKVDSSPTEEASLPTELQGNSLSPNTTEARERLDMFSNDQKL
TLQEEEPVTTSPDTTASQTVMQSDIGQMLDEGKKTDLARKTKAINDAHGNVLESPTTSDQ
KIARLDVSSVATDTEKLELKASTNVEASQPLQPVLEKTLHQLVTSRQQEQSGQGIASDVV
NGQRRDSRPTMFRIPEFKWSHMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVI
FVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLIS
LVDVLIFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKTRGDATK
GQKTVHSLIPMGKSTAKHKSPVDMVTGGISPVRDFDRLLQDMDINRLRAVVFRDIEDSKQ
AQFLALAVVYFISVLMVSKYRDILEPQNERRSQSFKGTLSETGTLSLPGKFPYFSPWYPK
PTLFHLFMRSLVKEQNGGHSWPRAENTPAASSPLTPVSVEESKSTSSARRRDSGIGEETA
AGLGSSVDAASPSVSAGPDAISEVLCTLSLEVNKSQDNRNDGGNEMDNKAAPSLPVSKNV
NVKDILRSLVNIPADGVPVDPALLPPPCLGALGDLSVEPPVQFRSFDRKVSLVHVKKKKV
KSVIIATKKSSVLPSTLTTNAPTNAVSVVSSVDSAQAPDMGGESPVSSKKICGRSSNAKL
PSVPAVGSVPQDQVSNMSITERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIE
GTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVAN
EAEFILSRQRAEDIHRHAEFESLCAQYSADKREDEKMCDHLIRAAKYRDHVTAIQLIQKI
INILTDKHGAWGNSALSRPREFWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHAA
DEDILAKGKQSIRSQALGNQNSENEILPEGDDDTLSSVDEKDLENFTGPVSLSTPAQLVA
PSVVVKGILSVTSSELYFEVDEEDPNFKNIDPKILAYTEGLHGKWLFTEIRSIFSRRYLL
QNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTCFGLPQTRRISLATPRQLFKA
SNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPSNFRD
LSKPVGALNPKRAAFFAERYESWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNL
QGGKFDHADRTFSSISRAWRNSQRDTSDIKELIPEFYYLPEMFVNFNDYNLGVMDDGTVV
SDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRSLNVFYYLT
YEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEPHPPRSSAMQVYLLLQSPLMFTDQ
AQQDVIMVLKFPSNSPVTHVAANTQPGLVTPAVITVTANRLFAVNKWHNLPGKKTHQGAV
QDQPYQLPVEIDPLIASNTGMHRRQITDLLDQSIQVHSQCFVITSDNRYILVCGFWDKSF
RVYSTDTGKLIQVVFGHWDVVTCLTRSESYIGGNCYILSGSRDATLLLWYWNGKSSGIGD
NPGSKSYSSGTTTPRAILTGHDYPITCAAICAELGLVLSGSTEGPCLIHSMNGDLLRTLE
GPENCLKPKLIQASREGHCVIFYENGFFCIFSVNGKLQATMETEDNIRAIQLSRDGQYLL
TGGDNGVVKVWQVSDLKQLFAYPGCDAGIRAMALSYDQRCIIAGMASGSIVLFYNDFNRW
HHEYQTRY
Download sequence
Identical sequences G1PU10
ENSMLUP00000014752 ENSMLUP00000014752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]