SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014754 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000014754
Domain Number - Region: 111-153
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0141
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014754   Gene: ENSMLUG00000016191   Transcript: ENSMLUT00000016194
Sequence length 196
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429777:11574528:11647268:1 gene:ENSMLUG00000016191 transcript:ENSMLUT00000016194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNTKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLMERLNSMLPEG
ERLEPFSMKPDRELKL
Download sequence
Identical sequences G1PU12
XP_005866874.1.60319 XP_006084311.1.53796 XP_006760283.1.95426 ENSMLUP00000014754 ENSMLUP00000014754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]