SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014794 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014794
Domain Number 1 Region: 137-232
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.53e-37
Family Cyclophilin (peptidylprolyl isomerase) 0.00000147
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.06e-28
Family Canonical RBD 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014794   Gene: ENSMLUG00000016233   Transcript: ENSMLUT00000016235
Sequence length 232
Comment pep:novel scaffold:Myoluc2.0:GL430027:367:13316:-1 gene:ENSMLUG00000016233 transcript:ENSMLUT00000016235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA
AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSE
PPKAEAQEGEPTAKKARSNPQVYMDIKIGNKPAGRIQILLRSDVVPMTAENFRCLCTHEK
GFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGRKFDDENFILKHTGPG
Download sequence
Identical sequences G1PU48
ENSMLUP00000014794 ENSMLUP00000014794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]