SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014804 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014804
Domain Number 1 Region: 3-300
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.09e-75
Family G proteins 0.000000000172
Further Details:      
 
Domain Number 2 Region: 517-624
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-24
Family Pleckstrin-homology domain (PH domain) 0.00000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014804   Gene: ENSMLUG00000016237   Transcript: ENSMLUT00000016248
Sequence length 856
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430232:65753:107544:1 gene:ENSMLUG00000016237 transcript:ENSMLUT00000016248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEDLIPLVNRLQDAFSAIGQNADSTAAVVGGQSAGSRARVQFFLGADFLPRGSGI
VTRRPLVLQLVNASTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLR
VYSPHVLNLTLVDLPGMTKVPVGDQPADIEFQIRDMLMQFVTKENCLILAVSPANSDLAN
SDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDID
GKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQ
LLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARIN
RIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREP
CLKCVDMVISELINTVRQCTKKESNLPRLREEMERIVTTHIREREGRTKEQVMLLIDIEL
AYMNTNHEDFIGFANAQQRSSQMNKKKASGNQDEILVIRKGWLTINNIGIMKGGSKEYWF
VLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQL
ELACETQEEVDSWKASFLRAGVYPERVGANETEENGSDNFMHSMDPQLERQVETIRNLVD
SYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDE
MLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVSPTSSPTPQRRAPAVPPARPGS
RGPAPGPPPAGSALGAAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPRLFPSRKGPAS
PTRPAVPRPPEAPLLD
Download sequence
Identical sequences G1PU58
ENSMLUP00000014804 ENSMLUP00000014804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]