SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014816 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014816
Domain Number 1 Region: 148-342
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.58e-57
Family Prokaryotic proteases 0.0000000215
Further Details:      
 
Domain Number 2 Region: 357-453
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-23
Family HtrA-like serine proteases 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014816   Gene: ENSMLUG00000016261   Transcript: ENSMLUT00000016260
Sequence length 456
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429953:2420783:2423950:1 gene:ENSMLUG00000016261 transcript:ENSMLUT00000016260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRAGRGAGWSLRGWRALGGFRWGKAPLLTPDLRALLTSGSPRARVTYGTPSLRARFS
VGVPGPRTCLTPGTSDSRARLTAGAPDPQTREGSGAPGSPPRTWLAVALGAGGAVLLLLW
GWGRGPPAVFAAVLRPPPTSPRSQYNFIADVVEKTAPAVVYIEILGRHPFSGREVPISNG
SGFVVAADGLIVTNAHVVADRRRVRVRLPSGDTYEATVTAVDPVADIATLRIQTKEPLPT
LPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSVQRPAKELGLPQNNVEYIQTDAAID
FGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLRRGEKKNSWFGTSGSQRRYI
GVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILDSPAHRAGLRPGDVILAIGEKVVQ
NAEDIYEAVRTQSQLAVRIRRGPETLTLYVTPEITE
Download sequence
Identical sequences G1PU69
ENSMLUP00000014816 ENSMLUP00000014816 XP_006096863.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]