SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014824 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014824
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-26
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014824   Gene: ENSMLUG00000016266   Transcript: ENSMLUT00000016268
Sequence length 125
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429852:4250305:4261339:-1 gene:ENSMLUG00000016266 transcript:ENSMLUT00000016268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQD
AVNLFRNAGYAVSLRVQHRLQVQNGPLGHRGEGEPSGIPMPVVLVPLFALTMVAAWAFMR
YRQQL
Download sequence
Identical sequences G1PU75
ENSMLUP00000014824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]