SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014841 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014841
Domain Number 1 Region: 16-469
Classification Level Classification E-value
Superfamily Ras GEF 9.81e-101
Family Ras GEF 0.00012
Further Details:      
 
Domain Number 2 Region: 555-648
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.36e-38
Family Ras-binding domain, RBD 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014841   Gene: ENSMLUG00000016276   Transcript: ENSMLUT00000016287
Sequence length 662
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430350:353229:367506:1 gene:ENSMLUG00000016276 transcript:ENSMLUT00000016287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSASQAPGRHASTFLHYRTSKVRMLRAAHLERLVRELVSVDCEQDPGFVPAFLATHQAFV
PTARVLGLLLPPPPPPLPPWVEIKKTEGQDLSFNKNLRAVVSVLGSWLRDHPQDFWDPPA
HSDLGRVRTFLGWAAPLGAEALEAEKLLRDFLEEAEQEQEEEEQPQASAGPPGTARTPSP
DSPEGLEEEEGLAQEGPELLDFSVDQVAEQLTLMDVELFSRVRPCECLGSVWSQRDPGAA
GIAPTVRATVTQFNLVTGCVLGSVLGAPGLAAPQRAQRLEKWIRIAQRCRELRNFSSLRA
ILSALQSNPIYRLKSSWGAVSREPLSTFRKLSQIFSDENNHLSSREILSQEEATEGPQEE
NTPPGSLPSKLPPGPVPYLGTFLTDLVMLDTALPDMLEGDLINFEKRRKEWEILARIQQL
QKRCRSYCLSPCPPILAALRAQRQLSEEQSYRVSRVIEPPAASCPSSPRVRRRISLTKRL
SAKLSRERGSSPGGSPGDPSSPTSSLSPGSPPSSPRMRDPPPGSPPASPGPQGPSTKVPG
LPLPLALTLSCPGISHVGQQGSEARVIRVSIDNDHGNLYRSILLTSQDKAPSVVQRALQK
HNVAQFWARDYQLFQVLPGEKELLIPDNANVFYAMSPAAPGDFVLRRRKKEEAQHTTSVS
PT
Download sequence
Identical sequences G1PU92
ENSMLUP00000014841 ENSMLUP00000014841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]