SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014848 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014848
Domain Number 1 Region: 155-295
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-35
Family cAMP-binding domain 0.00000178
Further Details:      
 
Domain Number 2 Region: 21-147
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-32
Family cAMP-binding domain 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014848   Gene: ENSMLUG00000016288   Transcript: ENSMLUT00000016294
Sequence length 305
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430535:187797:205546:1 gene:ENSMLUG00000016288 transcript:ENSMLUT00000016294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCAEAYNPDDEEEDTEPRVIHPKSDEQRCRLQEACKDILLFRNLDQEQLSEILDAMFEKI
VKADEHVIDQGDDGDNFYVIERGTYDILVTKDDQTRAVGQYDNRGSFGELALMYNTPRAA
TIVATSEGALWALDRGTFRRIIVKNNAQKRKTYESFLESVPLLKSLEVSERMKIVDVIGE
KAYKDGERIIAQGEKADSFYIIESGEVSILIKSKTKVNKEGGNQEVEIARCHKGQYFGEL
ALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSLDL
GDPGQ
Download sequence
Identical sequences G1PU99
ENSMLUP00000014848 ENSMLUP00000014848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]