SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014869 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014869
Domain Number 1 Region: 67-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000995
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014869
Domain Number - Region: 209-251
Classification Level Classification E-value
Superfamily EF-hand 0.000137
Family Polcalcin 0.049
Further Details:      
 
Domain Number - Region: 30-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000144
Family LDL receptor-like module 0.0043
Further Details:      
 
Domain Number - Region: 418-484
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.015
Family Mannose 6-phosphate receptor domain 0.022
Further Details:      
 
Domain Number - Region: 125-219
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0188
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014869   Gene: ENSMLUG00000016306   Transcript: ENSMLUT00000016318
Sequence length 484
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430350:333339:342819:-1 gene:ENSMLUG00000016306 transcript:ENSMLUT00000016318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLVLLLPACWAVEVRRPRGVSLTNHHFYDESKPFTCLDGSITIPFDQVNDDYCDCKDG
SDEPGTAACPNGSFHCTNTGYKPLYISSRWVNDGVCDCCDGTDEYNSGIVCENTCREKGR
KERETLQQMAEVTREGFRLKKILIEDWKKAREEKQQKLTELQTGKKSLEDQVEMLRTVKE
EAEKPEKEAKDQHQKLWEEQQAASKAQREQELAASAFQELDDNMDGVVSVAELQTHPELD
TDGDGVLSEGEAQGMASRDSCSRLCTVRTCSSVPLSTTSLLGPSVPPRPLPLRAWPSPPS
RVSPVGTPVPPLVMGSSSHRPVLPPSGACTALILAQAWPWQSARPPPPPPPPRGGGGGGP
PSGETRRAFLPAAQEARNKFEEAERSLRDMEEAIRNLEQEISFDFGPSGEFAYLYKQCYE
LTTNEYVYRLCLFKHVSQQLKLGGHLTLRSTWGSWAGSEHDRFSSMKYEQGTGCWQGPNC
STTV
Download sequence
Identical sequences G1PUB8
ENSMLUP00000014869 ENSMLUP00000014869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]