SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014871 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014871
Domain Number 1 Region: 876-1177
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000133
Further Details:      
 
Domain Number 2 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-29
Family Second domain of FERM 0.00041
Further Details:      
 
Domain Number 3 Region: 215-360
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-24
Family Third domain of FERM 0.0046
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-17
Family First domain of FERM 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014871   Gene: ENSMLUG00000016312   Transcript: ENSMLUT00000016320
Sequence length 1181
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429801:8833156:8896079:-1 gene:ENSMLUG00000016312 transcript:ENSMLUT00000016320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CHCPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
ITYFSLWYYNKQNQRRWVDLEKPLKKQLDKYALEPTVSFGVVFYVPSVSQLQQEVTRYQY
YLQLKKDILEGNIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALFPVGWLQDEKV
LEEATQKVALLHQKYRGLAAPEAEMLYMQEVERMEGYGEESYPAKNSYPVSLPSISCLGN
RFRKHKERKGPPVIFRWHDIANMSHNKSFFALELASKEETIQFQTEDMETAKYMWRLCVA
RHKFYRLNQCSLQTPTVTVNLIRRRSSSRMSLPKPQPYAMPAPPPLHYNGHYTEPYTSSQ
DNLFVTNQNGYYCHSQTSLDRAQIDLNGRIRNGSVYSAHSTSSLNNPQPYPQPSPMSSNP
SITGSDVMRPDYVPSHRHSALIPPSYRPTPDYETVMKQLNRGMAHAERQSHSLRNLNIGH
SFAYSRPDALVYSQPEIREHAHFPSPQSAHYPFSLNYSFHSQSPYPYPAERRPVVGAVSV
PELTNVQLQAQDYPAPNIMRTQVYRPPPPYPYPHPRPANSTPDLSRHLYISSSNPDLITR
RVHHSVQTFQEDSLPVAHSLQEVSEPLTAARHAHLQKRNSIELAGLTHSFDGMRLKDRTM
SASAADVAPRASFAGSQPNVFPDRTRRGETAEQEGLRYGHSKSLSEATMLIHSSDEEEEE
PEEDSRARAVLSPRAREPRGSYSQEPQAGCSCASASAGEGPLHIHEPKAHVTEAERRGRE
GSPVHVLAEAQRPRRDGLLTPSMSESDLTTSGRYRARRDSLKKRPVSDLLSGKKNIVEGL
PPLGGMKKSRVDAKKMGPLKLAALNGLSLSRLPLPDEGKDVSARATNDERCKILEQRLEQ
GMVFTEYERILKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINA
SHIKVSVSGMEWDYIATQGPLQNTCQDFWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPR
LGSRHNTVTYGRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPED
LKGFLSYLEEIQSVRRHTNSTSEPKGPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEV
LDIPRVLDKLRQQRMMLVQTLIQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences G1PUC0
ENSMLUP00000014871 ENSMLUP00000014871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]