SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014884 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014884
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-36
Family TFIIH domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 104-149
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000000000000392
Family BSD domain 0.0001
Further Details:      
 
Domain Number 3 Region: 185-232
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000123
Family BSD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014884   Gene: ENSMLUG00000016329   Transcript: ENSMLUT00000016335
Sequence length 548
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429891:1254081:1288124:-1 gene:ENSMLUG00000016329 transcript:ENSMLUT00000016335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYGDIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLNVNSTESSSTSNHKQDVGISAAFLADVRPQTDG
CNGLRYNLTSDIIESIFRTYPAVKMKYVENVPHSMTEKEFWTRFFQSHYFHRDRLNTGSK
DLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSTSNSKSIKENSN
AAIIKRFNHHSAMVLAAGLRKQEAQNEQNGEPSSIDGNSRDADCFQPAVKRAKLQESIEY
EDLGKNNSIKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ
VLSSSAATSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFP
VNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQ
SRRLLKKT
Download sequence
Identical sequences G1PUD2
ENSMLUP00000014884 ENSMLUP00000014884 XP_006093875.1.53796 XP_008147222.1.99482 XP_014315553.1.53796 XP_014315554.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]