SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014905 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014905
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily UBC-like 6.4e-42
Family UEV domain 0.000000167
Further Details:      
 
Domain Number 2 Region: 324-384
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.79e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014905
Domain Number - Region: 237-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00466
Family FCH domain 0.046
Further Details:      
 
Domain Number - Region: 152-211
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0144
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014905   Gene: ENSMLUG00000016353   Transcript: ENSMLUT00000016356
Sequence length 391
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429891:1166309:1197690:1 gene:ENSMLUG00000016353 transcript:ENSMLUT00000016356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSESQLKKMVSKYKYRDLTVRETINVITLYKDLKPVLDSYVFNDGSSRELMNLTGTVP
VLYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPTVSASYPPYQATGPPNTSYMPGMPSGISSYPSGYP
SNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLR
WRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELS
SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVF
LKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences G1PUF2
ENSMLUP00000014905 XP_006093868.1.53796 ENSMLUP00000014905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]