SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014923 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014923
Domain Number 1 Region: 65-339
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.77e-72
Family Protein kinases, catalytic subunit 0.0000248
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily SH3-domain 1.22e-17
Family SH3-domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014923   Gene: ENSMLUG00000016366   Transcript: ENSMLUT00000016375
Sequence length 928
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429952:2471987:2487740:1 gene:ENSMLUG00000016366 transcript:ENSMLUT00000016375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIWTAVFDYEVTGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGRLPGGRVGVFPSDYVAP
PRPAGPPASLPREIPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPERDPAVTA
EQVRKEARLLRSSAAPTILLLRGACLSPPHLCLVMEYARGGALSRVLAGRQVPPHVLVNW
AVQVARGMNYLHNEAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTT
KMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNK
LTLPIPSTCPEPFARLLEECWDPDPHGRPDFSSILKQLEVIEQSALFQMPLESFHSLQED
WKLEIQHMFNDLRTKEKELRSREEELLRAAQEQRCQEEQLRRREQELAQREMDIVERELH
LLMCQLSQEKPRVRRRKGNFRRTRLLKLREGGSHISLPSGFEHKITVQASPTLDKRKGSD
GTSPPASPSIIPRLRAIRCSGSSGSSTWGRSGPPKKEELVGGKKKGRTWGPSSTLQKEQA
EGEERLKALGEGSKQWSSSAPNLGKSPKHTPIAPGFASLNEMEELAEAEGNSSGPHSPHS
TLAYLEVPLPTQPSPGVPLPPTPTRPALGARRRRCEFALLGCATLLGAVGLGADVAEARA
ADGEEQRRWLDGLFFHRAGRFPRGLSPPARSPGRPNAASAGPGLAPSATLVSLSSVSDCN
STRSLLRSDSDEAAPAAPSPTPSPVAPSPNTNPLVDLELESFKKDPRQSLTPTHVTVTAT
RAVNRGHRRTPSDGALGQRGAPEPTGPGPATLGSTSLTSSDPLLPGPRDPLDFPHLPTPQ
APFPTHLQPPEFPGRPTTLTFTPRPRPAASRPCLDPWKRVSFGRTLSISPPNRLDAPESP
GPPSMQPTLLDMDMEGQSQDGTVPLCGA
Download sequence
Identical sequences G1PUG7
ENSMLUP00000014923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]