SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015036 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015036
Domain Number 1 Region: 1359-1528,1583-1648,1716-1815
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.45e-111
Family Mammalian PLC 0.00000563
Further Details:      
 
Domain Number 2 Region: 276-459,509-726,754-778
Classification Level Classification E-value
Superfamily Ras GEF 1.18e-39
Family Ras GEF 0.0059
Further Details:      
 
Domain Number 3 Region: 2101-2212
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.78e-37
Family Ras-binding domain, RBD 0.00000144
Further Details:      
 
Domain Number 4 Region: 1975-2081
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.17e-31
Family Ras-binding domain, RBD 0.00000181
Further Details:      
 
Domain Number 5 Region: 1841-1952
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-22
Family PLC-like (P variant) 0.0034
Further Details:      
 
Domain Number 6 Region: 1175-1206,1284-1347
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000394
Family EF-hand modules in multidomain proteins 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015036
Domain Number - Region: 856-897,931-1008
Classification Level Classification E-value
Superfamily PH domain-like 0.00119
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015036   Gene: ENSMLUG00000016487   Transcript: ENSMLUT00000016500
Sequence length 2267
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429833:3580583:3824067:-1 gene:ENSMLUG00000016487 transcript:ENSMLUT00000016500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEEMAASDLIPVTQRKVVSSQSAADESSEKASGVSVPKTHTPGQSRPTSHTISKLNKP
NEETSGSNLPRILSTTRGKIMSDENSNETCWEKNMPDSVKNLNVNGNNILENRQCGLPQS
QFYKTCDSVVEEGLHLETGIPSSLERKVFPGIQLELDRPPTGIRPLGNQSATSRAHPDSD
LAVFHFHYELDRRMSDSVCSLSDNLILDDCGNCVSLPDVGREQKKNYMAYTCKLMELAKS
CDNENKQRQGDHCDALNDEYMCCEASCRKANVVCSSDSFCREGFTDSPSAETFLSHFEDF
PDNCEDVEDYFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLAAWSYI
DMKRSGSSLPCGRVTGQLSTVLIRQDGSPCLSEAQWYPWCMIYNAVRRGEETEDTIGSLL
HFFTKLPASETAYERINVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGAR
SGLLSTFGGSTGRMMLKERQPGTSVANSSALPSSSAGISKELIDLQPLIQFPEEVASILM
EQEQNIYRRVLPVDYLCFLTQNLSTPECQRSLPCLKASISASILNSQNREHNALEDLVMR
FNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNTVMEFLAGLRSRKVLKMW
QFMDQSDLETMRSLKDAMAQHESSCEYRKVVTRALHIPGCRVVPFCGVFLKELCEVLDGT
SGLVKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQIIRSCSRS
LEAEDEDSPSEGSGSRKNSLKDKARCQFVIGDLLDTENDIFEQPKEWDPHGLEEPQKAFD
HGIELIPWYVLSIRADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWIKPTTAS
PASAKAKLGMPAATSEPGKFPLLGNAGLSGLAEGVLDLFSVKAVYMGHPSIDIHTVCVQN
KLSSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTKAVRKMRKFPDQRQ
QWLRKQYVSLYQEDGAYEAPAWTRTAESFGRRRYMQRNNTLGIGTAKKKKKILMRGESGE
ATDDEMATRKAKLHKECRSWSGSDPQDINEQEESEANAITSPPNPLPSRRAHSLTTAGSP
ILAAGTSSPISAWSSSSWHGRIKGGMKGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLK
DLFDLYAVPCNRSGSESAPLYTNLTIDENTSGLQPDLDLLTRNVSDLGLFIKSKQQLSDN
QRQISDAIAAASIVTNGTGVESTSLGVFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFE
PSISMCHQGLMSFEGFARFLMDKDNFASENDESQENIKELQLPLSYYYIESSHNTYLTGH
QLKGESSVELYSQITYQSCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKDVIEAIDRSAF
INSDLPIIISIENHCSLPQQRKMADIFKTVFGEKLVAKFLFESDFSDDPMLPSPDQLRRK
VLLKNKKLKAHQTPVDILKQKAHQLASMQAQAYNGGNVNPPPTNNEEEEDEEDEYDYDYE
SLSDDNILEDRPESKSCSDKLQFEYNEEIPKRIKKADNSACNKGKVYDMELGEEFYLPQN
KKESRQIAPELSDLVIYCQAVKFPGTGLSTLNASGSNRGKERKSRKSIFGNNPGRMSPGE
TASLNKTSGKSSYEGMRQAWEESSSPLSPATSLSAIIRTPKCYHISSLNENAAKRLCRRY
SQKLIQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDDLPLHLNAAMFEA
NGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDNMEPAVYSLTIVSGQNVCPSNSTGSPCI
EVDILGMPLDSCHFRTKPIHRNTLNPMWNEQFFFRVHFEDLIFLRFAVVENNSSAVTAQR
IIPLKALKRGYRHLQLRNLHNEVLEISSLFVNSRRMEEISSGSSVPASLMFSTEERKCLQ
THRVTVHGVPGPEPFTVFSINGGTKAKQLLQQILTTEQDTKPIAADYFLMEEKYFISKEK
NECRKQPFQRAIGPEEEIVQILSSWFPEEGYVGRIVLKTQQENLEEKSIVQDDREVILSS
EEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPNDYVLLEE
VVKDTANKKSSTPKPSQRVLLDQECVFQAQSKWKGAGKFILKLKEQVQASREDKRKGISF
ASEFKKFTKSTKQPRGLTLPSQVLVSESVQNKEERPVGGSDTMDYRQ
Download sequence
Identical sequences G1PUR8
ENSMLUP00000015036 ENSMLUP00000015036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]