SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015037 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015037
Domain Number 1 Region: 13-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-66
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015037
Domain Number - Region: 315-375
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0846
Family Ubiquitin-related 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015037   Gene: ENSMLUG00000016496   Transcript: ENSMLUT00000016501
Sequence length 746
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430148:164799:196218:-1 gene:ENSMLUG00000016496 transcript:ENSMLUT00000016501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHSNVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLSWDPQQRGGPIDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTASQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYDGPFASRSLSDSVNYIVRDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNTNLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMCLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPPDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIREADNSVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLDGAVTTPQASAWLPPTSAEREHPLSCVVTPQDGETLAQMIEENVNCLGH
LSTIIHEVNEEQSSRMMNLDWSWLTE
Download sequence
Identical sequences G1PUR9
ENSMLUP00000015037 ENSMLUP00000015037 XP_006101780.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]