SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015042 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015042
Domain Number 1 Region: 243-347
Classification Level Classification E-value
Superfamily PH domain-like 1.43e-30
Family Pleckstrin-homology domain (PH domain) 0.00000356
Further Details:      
 
Domain Number 2 Region: 116-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-28
Family DEP domain 0.00000124
Further Details:      
 
Domain Number 3 Region: 4-102
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-25
Family Pleckstrin-homology domain (PH domain) 0.00000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015042   Gene: ENSMLUG00000016505   Transcript: ENSMLUT00000016506
Sequence length 350
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429875:1856973:1878874:-1 gene:ENSMLUG00000016505 transcript:ENSMLUT00000016506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQ
DFGKRMFVFKITTTKQQDHFFQAAFLEERDGWVRDIKKAIKCIEGGQKFARKSTRRSIRL
PETVDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLLSNKSVRNRQEGLMI
ASSLLNEGYLQPAGDLSKNAVDGTAENAFLDNPDAFYYFPDSGFFCEENSSDDDIILKEE
FRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGGEDPLGAIHLRGCVVTSV
ESNPDAKKSEEENLFEIITADEVHYFLQAATPKERTEWIKAIQVASRTGK
Download sequence
Identical sequences G1PUS2
XP_006093048.1.53796 ENSMLUP00000015042 ENSMLUP00000015042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]