SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015098 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015098
Domain Number 1 Region: 8-289
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-63
Family Protein kinases, catalytic subunit 0.00000744
Further Details:      
 
Domain Number 2 Region: 896-957
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.79e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0028
Further Details:      
 
Domain Number 3 Region: 975-1091
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000235
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015098
Domain Number - Region: 1124-1193,1245-1375
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0051
Family Tricorn protease domain 2 0.019
Further Details:      
 
Domain Number - Region: 325-511
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0112
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015098   Gene: ENSMLUG00000016550   Transcript: ENSMLUT00000016570
Sequence length 1621
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431356:2160:44404:-1 gene:ENSMLUG00000016550 transcript:ENSMLUT00000016570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVQEQEAQTACFREERDVLVNGDCQWITTLHYAFQDENYLYLVMDYYVGGDLLTLLSKFE
DKLPEDMARFYIGEMVLAIDSIHQLHYVHSNRDIKPDNVLLDANGHIRLADFGSCLKMND
DGTVRSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLV
ETYGKIMNHEERFQFPSHVTDVSEEAKDLMQRLICSRERRLGQNGIEDFKKHPFFQGLNW
ENIRNLEAPYIPDVSSPSDTSNFDVDDDVLRNIEMLPPGSHTGFSGLHLPFIGFTFTTES
CFSDRGSLKSMMQSSTLTKDEGVQRDLESSLQAEAYERRIRRLEQEKLELSRKLQESTQT
VQSLHSSARGLGGVARDKEVKKLTEEIERLKNKIADSNKLERQLEDAVALRSEQEGSALR
LKGLEKQYRVARQEKEDFHKQLVEASERLKSQAKELKDAHQQRKLALQEFSELSERVAEL
RAQKQKVSRQLRDKEEEVEAAMQKVDSMRQEVRKSERLRKELEARLEDAVAEASKERKLR
EHSESFSKQLESELEALKGKQGGRGPGASLEHQQEISKIKSELEKKVLFYEEELVRREAS
HVLEVKTVRKEVHDSESHQLALQKEILMLKDKLEKSKRERLSEVEEAVGTVKDKLERDRA
VLSEENKKLAAEKERLCSFVDKLTAQNRQLEDELQDLAAKKESVAHWEAQIAEIIQWVSD
EKDARGYLQALASKMTEELEALRSSSLGSRTLDPLWKVRRSQKLDMSARLELQSALEAEI
RAKQLVQEELRKAKDSNLSFESKLKDSEAKNKELLEEMEILKKKMEEKFRADTGLKLPDF
QDSIFEYFNTAPLAHDLTFREAAECRASPTPRAPFPAPRVPHLPLFRRSSCPNLSVFSPQ
PKAHQFSIKSFSSPTQCSHCTSLMVGLLRQGYACEVCSFACHVSCRDSAPQVCPLPPEQA
RRPLGVDVQRGIGTAYKGYVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKSTQPGVV
ASQVLDLRDEEFSVSSVLASDVIHASRRDIPCIFRVTASLLGSPSKTSSLLILTENENEK
RKWVGILEGLQSILQKNRLRNQVVHVPQEAYDSSLPLVKAVLAAAVLDGDRIVVGLEEGL
YVIEVTRDVIVRVADYKKVYQIELAPKEKVAALLCGRNHHVHLCPWSAFDGTESNVDVKL
PETKGCQLLATATLKKSAATCLLVAVKRLVLCYEVQRTRPFHRKVTELAAPGSVQCMAVL
KDKLCVGYPSGFSLLSLQGDGQALPLVNPHDPSLAFLSQQSFDALCAVELKSEEYLLCFS
HMGLYVDPQGRRSRTQELMWPAVPVACSCSPSHVTVYSEYGVDVFDVCTMEWVQTIGLRR
IRPLNTEGTLNLLNCEPPRLIYFKSKFSAGTVLNVPDTSDNSRKQMLRTRSKRRFVFKVP
EEERLQQRREMLRDPELEIQDDFQPRTNFNHVAHMGPGDGNAGCSWTSTWPRGSFRGGAG
AAASLPIEGKAAPAPAGSPASGDAAETTGQRGRWALTQAAPGLESLPSRPLPPPDGREGL
CSAHGSPGVHLRAREAEQPDSDSTKHSTPSNSSNPSGPPSPTSPHRSQLPLEGLEPPAYD
A
Download sequence
Identical sequences G1PUX0
ENSMLUP00000015098 ENSMLUP00000015098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]