SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015175 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015175
Domain Number 1 Region: 309-475
Classification Level Classification E-value
Superfamily Cyclophilin-like 5.55e-45
Family Cyclophilin (peptidylprolyl isomerase) 0.000000258
Further Details:      
 
Domain Number 2 Region: 38-105
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000689
Family U-box 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015175   Gene: ENSMLUG00000016641   Transcript: ENSMLUT00000016652
Sequence length 548
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430043:499520:528333:-1 gene:ENSMLUG00000016641 transcript:ENSMLUT00000016652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRQHQKDKMYITCAEYTNFYGGKKPDIPQTNFRRLPFDHCSLSLQPFSYPVCTPEGVV
FDLLNILPWLKKYGTNPSNGEKLDGRSLIKLNFAKNSEEKYHCPVLYTVFTNNTHIVAIR
TTGNVYAYEAVEQLNIKAKNFRDLLTDEPFSRQDIITLQVRSLPCALGRGLENLGAAALC
QPHSPPRDPTNLDKFNVSNFFHVKNNMKITDPDEEKAKQDPSYYLKNTNAETRETLQELY
KEFKGDEVLAATMKAPEKKKVDKLNAAHYSTGKVSASFTSTAMVPETTHEAAAIDEDVLR
YQFVKKKGYVRLHTNRGDLNLELHCDMTPKTCENFIKLCKKQYYDGTIFHRSIRNFVIQG
GDPTGTGTGRYWCWASLGSFGCPIGPEGVGGWDMLSSRPLGTHLFFFITFRSCAYLDKKH
TIFGRVVGGFDTLTAMENVESDPKTDRPKEEIRIDSTTVFVDPYEEADVQIAEERKKTQL
AEAAPESTVKKSQSKSGSQGPPTYRQGVGKYINPAATKRAADEEPSTSAAIPVAKKKPSG
GFKDFSAW
Download sequence
Identical sequences G1PV35
ENSMLUP00000015175 ENSMLUP00000015175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]