SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015202 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015202
Domain Number 1 Region: 14-304
Classification Level Classification E-value
Superfamily Ras GEF 1.22e-79
Family Ras GEF 0.0000357
Further Details:      
 
Domain Number 2 Region: 457-580
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-17
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015202   Gene: ENSMLUG00000016672   Transcript: ENSMLUT00000016681
Sequence length 587
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430164:600619:787813:-1 gene:ENSMLUG00000016672 transcript:ENSMLUT00000016681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITL
MDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAE
ILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSK
EDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRII
ADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKE
DLAGPSASSSSARFSRRPTCPDASVAGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSAT
FPSEKARHLLDDSVLESRSPRRGPALTSSSSAVTNGLSLGSSESSEFSEEMSSGLERSRG
RLYATLGPNWRVPVRNSPRTRSCVYSPTGPCICALGSSAAVPTMEGPLRRKTLLKEGRKP
TLSSWTRYWVILSGSTLLYYGAKSLRGTDRKHYKSTPGKKVSIVGWMVQLPDDPEHPDIF
QLNNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQVPANLMSFE
Download sequence
Identical sequences G1PV61
ENSMLUP00000015202 ENSMLUP00000015202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]