SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015288 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015288
Domain Number 1 Region: 932-1054
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-26
Family Ankyrin repeat 0.000000235
Further Details:      
 
Domain Number 2 Region: 10-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.4e-22
Family Ras-binding domain, RBD 0.014
Further Details:      
 
Domain Number 3 Region: 1060-1121
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-17
Family SH3-domain 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015288   Gene: ENSMLUG00000016772   Transcript: ENSMLUT00000016778
Sequence length 1130
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430402:39349:67468:-1 gene:ENSMLUG00000016772 transcript:ENSMLUT00000016778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQFGGDSFQMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSER
PVADNERMFDVLQRFGSQRSDVRFFLRHERPPGRDFVSGPRPQDPTLKRNGVKVPGDHRR
KENGVNSPRMDLTLAELQEMASRQQQQIEAQQQMLATKEQRLKFLKQQDQRQQQQAAEQE
KLRRLKEIAENQEAKLKKVRALKGHVEQKRLSNGRLVEEIEQMNSLFQQKQRELVLAMSK
VEELTRQLEMLKNGRIDGHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKR
NSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSPDGNLPPPGVSAPSRVAAVGPYIQSS
TMPRMPSRPELLVKPALPDGPLAMQPAEGPMKVHTLPNMRSGAAAQTKGSKVHSLGPDWS
PHADLFPSQASASAPKGAGSAPDPADDGEVPPREKEKKVRPFSMFDTVDQAAAPPAFGSL
RKNQSSEDILRDAQAANKNGKVPPPVPSKPKQINLPYFGQTSASPSDMKPDGNPPQLSAA
VASVGNKPKPAGQPQRGLLAPGAPSGGQDPALVPGAKQESPPAAAVRPFTPQPSKEAGLP
PFRRPQTVAASSIYSMYTQHQAPGKSFQQAVQSALTKAQPRGPHFPSVYGKPVIAAQNPQ
PLDSMYSGNQGKPGGPESDMEPASSVPESHENERIPRPLSPTKLLPFLSHPYRNQSDVDL
EALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPATASAVT
AGPESPVEIQNPYAHAEPEKEVASLAPEPVSPEAAAHASTASSDVPAPPLGLDYVSEGAP
DTSPSFPNNVEEPNPEAPHLLEVYLEEYPPYPPPPYPSGEPEGLGEDSGSLRPPEITGQV
SLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVEDPSLPNDE
GITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAV
FAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNEDELPM
KEGDCMTVLRREDEDEVEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA
Download sequence
Identical sequences G1PVD2
ENSMLUP00000015288 ENSMLUP00000015288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]