SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015308 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015308
Domain Number 1 Region: 139-350
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.36e-66
Family Arfaptin, Rac-binding fragment 0.0012
Further Details:      
 
Domain Number 2 Region: 18-97
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-16
Family PDZ domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015308   Gene: ENSMLUG00000016795   Transcript: ENSMLUT00000016800
Sequence length 413
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430180:517715:531962:1 gene:ENSMLUG00000016795 transcript:ENSMLUT00000016800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFADLDYEIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKSCLTSHSSRLQGKSPVLSFLPSSPSA
RAQGGLGSGSAVQNGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKTLLRAFYELSQT
HRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAI
PDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQE
ARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLRDADVFPIEVD
LAHTTLAYGPGQDEFTDGEDEEEDDEDTAAREPSRDARGAAGPLDKGGSWCDS
Download sequence
Identical sequences G1PVE8
ENSMLUP00000015308 ENSMLUP00000015308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]