SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015332 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015332
Domain Number 1 Region: 100-256
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.48e-29
Family UbiE/COQ5-like 0.041
Further Details:      
 
Domain Number 2 Region: 2-80
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00000000000439
Family AlkB-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015332   Gene: ENSMLUG00000016822   Transcript: ENSMLUT00000016824
Sequence length 406
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430015:15547:33429:1 gene:ENSMLUG00000016822 transcript:ENSMLUT00000016824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVMDFKHPDGVTVPVMLPRRSLLVMTGESRYLWTHGITPRKFDTVQASKGHKSGIITGDV
GDLTLSKRGIRTSFTFRKVRQTPCDCSYPLVCDSQMKEPPPSFPESDKEASQLEQKYVHQ
VYEEIAGHFSSTRHTPWPHIVEFLKALPSGSLVADVGCGNGKYLGINKELYMVGCDRSQN
LVDICRERQFQAFVCDALAVPVRSGSCDACISIAVIHHFATAERRMAALEELARLLRPGG
KALIYVWAMEQEYKKKKSKYLRENRTSQGRQEINSDPSAQEQFVEPVPDTGHQDSACSVP
SINDFQKGRCNSKEVANCKLPIHTNRTSFHSQDLLVPWHLKGNASKEKPTEPFGPAGTHD
PGPVFHRYYHVFCEGELEAACQTLNNVSILQSYYDQGNWCVILQKV
Download sequence
Identical sequences G1PVG8
ENSMLUP00000015332 ENSMLUP00000015332 XP_006098899.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]