SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015336 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015336
Domain Number 1 Region: 1377-1571,1610-1751
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.92e-46
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.03
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015336
Domain Number - Region: 1023-1058
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00293
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015336   Gene: ENSMLUG00000016818   Transcript: ENSMLUT00000016828
Sequence length 1760
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429795:6723254:6784022:-1 gene:ENSMLUG00000016818 transcript:ENSMLUT00000016828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAAASPVGKRLLLLFADTTASASASVPAAAASAGGDPGPALRTRAWRAGTVRAMSGAV
PQDLAIFVEFDGCNWKQHSWVKVHAEEVIVLLLEGSLVWAPRKDPVLVQGTRVSIAQWPA
LTFTPLVDKLGLGSVVPVEYLLDRELRFLSDTNGLHLFQMGTESQNQILLEHAALRETVN
ALISDQKLQEIFSRGPYSVQGHRVKVYQPEGEESWLYGIVNHQDSITRLMDVSITESGEI
KSVDPRLIHVMLTDNSTPQNEGGTLKAVKSSKGKKKRESIEGKDGRRRKSASDSGCDSAS
KKLKGDRGEVDSNGSDGGEASRGPWKGGNASGEPGLDQRTKPPPTTFVPQINRNIRFATY
TKENGRTLVVQDEPVGGDTTAPFTPYPTATGQTPLAPEAGGAESKEAGKTLEQVGQGLVA
SAAMVTTASSTPTTVRISDTGLAAGTGPEKQKGSWSQAPGENSRNSVLVSSGFGASLPSL
SQPLTFGSGRSQSNGVVATENKPLGFSFGSSSAPESQKDSDLSKNLFFQCMPQTLPTSNY
FSTVSESLADDSSSRDSFKQSLESLCKGRSTLGADTKSGSKAGSVDQKVPTESMPTLTPA
FPRSLLNARTPESHENLFLQPPKLSREEPSNPFLAFVEKVEHSPFSGFASQASSGSSSSA
TTVTSKAAPTWPESHSSSDSASLAKKKTLFITTDSSKLVSGVLGSALTTGGPSLSAMGNG
RSSSPTSSLTQPIEMPTLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGSFLSSPADF
SQENKAPFEAVKRFSLDERSLACRQDSDSSTNSDLSDLSDSEEQLQAKTGLKGIPEHLMG
KLGPNGERSAELLLGKGKGKQAPKGRPRTAPLKVGQSVLKDVSKVKKLKQSGEPFLQDGS
CINVAPHLHKCRECRLERYRKFKEQEQDDSTVACRFFHFRRLIFTRKGVLRVEGFLSPQQ
SDPDAMNLWIPSSSLAEGIDLETSKYILANVGDQFCQLVMSEKEAMMMVEPHQKVAWKRA
VRGVREMCDVCETTLFNIHWVCRKCGFGVCLDCYRLRKSRHAVPHNSETEEMGDEEVFSW
LKCAKGQSHEPENLMPTQIIPGTALYNIGDMVHAARGKWGIKANCPCISRQNKSVLRPAV
TNGMSQLPSINPSASSGSETTFSGGGGTAAVTAPEPDPKADSTDIRADEPPKADSLASNS
NSELKAIRPLCPDTAPPSSALHWLADLATQKAKEETKEAGSLRSVLSKESHSPFGLDSFN
STAKVSPLTPKLFNSLLLGPTASNNKTEGSSLRDLLHSGPGKLPQTPLDTGIPFPPVFST
SSAGVKNKASLPNFLDHIIASVVENKKTSDAAKRACNLTDTQKEVKEMVMGLNVLDPHTS
HSWLCDGRLLCLHDPSNKNNWKIFRECWKQGQPVLVSGVHKKLKSELWKPEAFSQEFGDQ
DVDLVNCRNCAIISDVKVRDFWDGFEIICKRLRSEDGQPMVLKLKDWPPGEDFRDMMPTR
FEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHL
DVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKD
AEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAV
FIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNIIY
HAVKDAVGTLKAHESKLARS
Download sequence
Identical sequences G1PVH1
ENSMLUP00000015336 ENSMLUP00000015336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]