SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015382 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015382
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000327
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015382   Gene: ENSMLUG00000016876   Transcript: ENSMLUT00000016877
Sequence length 79
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429773:18127270:18133324:-1 gene:ENSMLUG00000016876 transcript:ENSMLUT00000016877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGFGRLEHFSGAVYEGYFKDNMFHGLGTYIFPSGAKYTGNFNENRVEGEGQYTDIQGLE
WCGTFHFTAAPGLRLKLHM
Download sequence
Identical sequences G1PVL2 L5MBX1
ENSMLUP00000015382 XP_005864797.1.60319 XP_005864798.1.60319 XP_006083495.1.53796 XP_006083496.1.53796 XP_006755990.1.95426 XP_006755991.1.95426 XP_014303501.1.53796 XP_014303510.1.53796 XP_014393916.1.60319 XP_014393917.1.60319 XP_014393918.1.60319 XP_015414359.1.95426 XP_015414360.1.95426 ENSMLUP00000015382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]