SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015447 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015447
Domain Number 1 Region: 224-385,443-505
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-39
Family Voltage-gated potassium channels 0.0046
Further Details:      
 
Domain Number 2 Region: 508-693
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-35
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.62e-21
Family Flavin-binding PAS domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015447   Gene: ENSMLUG00000016937   Transcript: ENSMLUT00000016946
Sequence length 1077
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429858:3335076:3351461:1 gene:ENSMLUG00000016937 transcript:ENSMLUT00000016946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISDTKSRGGPDKWKETGRGRRRYGRARAKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKKVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTARESSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVSTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACVWFYIGQQEIESSASELPEIGWLQELARRLETPYYLVGRSPAAA
NSSDQSDNCSSEANRTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKIFS
ICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRMLEYF
QTTWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALRPAF
CTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRREQVVKANADV
KGLTYCVLQCLQLAGLHESLALYPEFAPRFSQGLRGELSYNLGAGGGPTEADTSSLSGGD
TLMSTLEEKETDGEQGPAASPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRSRLGGR
GRPGRAGTEAGPSAHPRSLEGLQLPPVPWNVPPDLSPRVVDGIEDGCGSDQPKFSFRMGQ
SVPECSSSSSPGPENSLLTLPLGPSEASNTDTLDKLRQAVMELSEQVLQMREGLQSLRQA
VQLLLAPHREGPCPQASGEGPGPASTSGLLQPLCVDTGVSSYCLQPPAGSVLSGTWPHPR
PGAPPLMAPWPWGPPASQSSPWPQTTAFWTSTSDSEPLGSGELCPEPSTPGSPPPEEEAR
TEPLDPVSQAEAASTGEPPPGSGGLALSWEPHSLEMVLIGCHGPGTVQWTQEEGTGV
Download sequence
Identical sequences G1PVR7
XP_006091586.1.53796 ENSMLUP00000015447 ENSMLUP00000015447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]