SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015465 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015465
Domain Number 1 Region: 2-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-60
Family G proteins 0.00000000582
Further Details:      
 
Domain Number 2 Region: 447-552
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-26
Family Pleckstrin-homology domain (PH domain) 0.000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015465   Gene: ENSMLUG00000016958   Transcript: ENSMLUT00000016966
Sequence length 792
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429821:105414:394722:1 gene:ENSMLUG00000016958 transcript:ENSMLUT00000016966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPG
ITKVPVGDQPVDIEHQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKDVDPQGLR
TIGVITKLDLMDEGTDARDILENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFF
LSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQAQMLSIEHEVDAYKNFKP
EDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVKMEF
NEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVMQELINTV
KKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANA
QQRSSQVHKKNTIGNQGTNLPPSRQIVIRKGWLTISNIGIMKGGSKGYWFVLTAESLSWY
KDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFAIFNTEQRNVYKDYRFLELACDSQEDV
DSWKASLLRAGVYPDKSLTENDENGQAENFSLDPQLERQVETIRNLVDSYMSIINKCIRD
LIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAEQAQRRDEMLHMYQALKEAL
VIIGDINTATTFIPAPPPVDDSWIQHTRRSPPPSPTTQRRPTLSTPLARPGSGRGPPPAI
PSPGPHSGAPPVPFRPGPLPPFPNSNDTYGAPPQVPSRPTRAPPSVPRPGVRSREPPSPP
EKLCPTGSTSLS
Download sequence
Identical sequences G1PVT0
ENSMLUP00000015465 ENSMLUP00000015465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]