SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015509 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015509
Domain Number 1 Region: 77-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.51e-47
Family Regulator of G-protein signaling, RGS 0.000000454
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015509
Domain Number - Region: 11-52
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0968
Family Troponin I 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015509   Gene: ENSMLUG00000017009   Transcript: ENSMLUT00000017013
Sequence length 235
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429900:3643659:3657991:1 gene:ENSMLUG00000017009 transcript:ENSMLUT00000017013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSLLFFSQRNMWESKEKTFFKLMPGSAKEEASKEAKIRAKEKRNRLSLLLQKSEFHEE
PQARRSAHLAGVTRVCPEEAIRWGESFDKLLSHKDGLETFTRFLKTEFSEENIEFWMACE
DFKKSKDPQQMILKAKAIYEKFIQNDAPQEVNLDFHTKELIVKSITQPTLHSFDAAQSRV
YQLMEQDSYTRFLKSDIYSDLVEGRPQRPTNLRRRSRSFTYNEFQDVKSDVAIWF
Download sequence
Identical sequences G1PVW4
XP_006094386.1.53796 ENSMLUP00000015509 ENSMLUP00000015509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]