SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015512 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015512
Domain Number 1 Region: 575-758
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-38
Family DBL homology domain (DH-domain) 0.00000392
Further Details:      
 
Domain Number 2 Region: 772-894
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-25
Family Pleckstrin-homology domain (PH domain) 0.00021
Further Details:      
 
Domain Number 3 Region: 294-400
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000202
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 4 Region: 17-168
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000209
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015512   Gene: ENSMLUG00000017007   Transcript: ENSMLUT00000017016
Sequence length 894
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429781:11290513:11424550:1 gene:ENSMLUG00000017007 transcript:ENSMLUT00000017016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADEIMQQEIRPLLAVDIIEQLHRQFAILSGGRGKDGAPIITFPEFVGFKHISDEDFLNVM
TYLTSIPSVEAASIGFVIVIDRRRDKWSSIKASLTRIAVAFPGNLQLIFILRPSRFIQRT
VTDIGIKYYQDEFKMKVPIVMLNSVSDLQGYIDKSQLTEDLGGTLEYRHSQWISHRTAIE
NFALTLKTTAQTLQMFGARLAATELPRGVPSTAELLMSHTKQRDKLQDELKLLGNQGATL
LSCIQQPATKSPTRKLSPNQLENVATMERLLVQLDDTEKAFSRFWSKHHLKLSQCLQLQH
FEHNFCEVKLALDNLLAEQAEFTDIGDSVMRVERLLKEHKKLEGKGQESLEKAQLLATIG
DQLIQSHHYAADSIRPKCVELRHLCDDFFNENKKKHDILEKSLELHRQLDKVSRWCEAGI
YLLASQAVDKCQSREGVDVALTDIEAFLDTATEQQLPSPKEIYNQFELILTPDVKANTQK
VLQKLGDVQEIFHKRQVSLMKLAARQTRPVQPVAPHPESSPKRLPSESPNFSWKKTHETN
SREGSQSGKGGLKKKKRFLKTPKEGSLSSYKSEETSYSVTVWCLIRDLLETEEVYIKEMK
SIIDGYITPMDYIWLKHLIPDVLQNNKDFLFGNIRELYEFHNRTFLKELEKCTENPELLA
RCFLKRKEDLQIYFKYHKNLPRAQAIWQECQDCAYFGVCQRQLDHSLPLFKYLRGPSQRL
TNYQMLLKDGPKRTKDPAFLAELQQALAMIEELIHSCELAVDLAAVTGCPEDIGELGRLL
RHGAFSVWTVHKERSKVTGFIRFKPSQRQLYLFERGIVFCKIRMEPSDQGPAPHYSFKKS
MKWTTLSIHQLERGSNRKFELVDRNGLEKYILQAASKEIRDCWFSEISKLLMEQ
Download sequence
Identical sequences G1PVW7
ENSMLUP00000015512 ENSMLUP00000015512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]