SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015518 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015518
Domain Number 1 Region: 258-335
Classification Level Classification E-value
Superfamily SH3-domain 6.56e-22
Family SH3-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015518   Gene: ENSMLUG00000017023   Transcript: ENSMLUT00000017023
Sequence length 336
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430558:139784:153728:1 gene:ENSMLUG00000017023 transcript:ENSMLUT00000017023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNNPIPSNLKSEAKKAAKILTAHLLSLTFAAHVIAKAKGLAVLSVIKAGFLVTARGGSGI
VLARLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYGRAVEAFAKGGNLTLGGNLT
VAVGPLGRNLEGNVALRSSAAVFTYCRSRGLFAGISLEGSCLIERKETNRKFYCQDVRAY
DILFGDMPRPAQAEELYEILDSFTEKYESEGQRINARRAARERSPPKAQELPPKPLSRPQ
PSSPQGPLSSGSQTGDRNEYKLYPELPSYPERVGNSSRPTEVTALYSFEGQQPGDLSFKA
GDRITVTSKTDSNFDWWEGRLRGQTGIFPANYVTMN
Download sequence
Identical sequences G1PVX3
ENSMLUP00000015518 ENSMLUP00000015518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]