SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015519 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015519
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-32
Family Pleckstrin-homology domain (PH domain) 0.000000442
Further Details:      
 
Domain Number 2 Region: 171-268
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000166
Family SH2 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015519   Gene: ENSMLUG00000017022   Transcript: ENSMLUT00000017024
Sequence length 297
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429926:2807692:2841963:1 gene:ENSMLUG00000017022 transcript:ENSMLUT00000017024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLVKRSEYQEYKQYWTELRGTTLFFYNDK
KSTIYVDKLDIIDLTCLNEQNSTDKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTIT
ELSVPQHVSLLPGQVIRLHEVLEKEKKRRIETERLPSTSPEEEREPIEDYVDVLNPMPAC
FYAVSRKEATEMLEKNPSLGNMILRPGSDSRNFSITIRQEIDMPRIKHYKVMRVGKSYTI
ELEKPVTLPNLFSVIDYFMKETRGNLRPFIYSTDENLVNLYIKESKAKKNKTKPNPV
Download sequence
Identical sequences G1PVX4
ENSMLUP00000015519 ENSMLUP00000015519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]