SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015532 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015532
Domain Number 1 Region: 880-1181
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000124
Further Details:      
 
Domain Number 2 Region: 212-355
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-31
Family Third domain of FERM 0.0072
Further Details:      
 
Domain Number 3 Region: 105-211
Classification Level Classification E-value
Superfamily Second domain of FERM 5.76e-27
Family Second domain of FERM 0.00054
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-20
Family First domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015532   Gene: ENSMLUG00000017033   Transcript: ENSMLUT00000017037
Sequence length 1185
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429832:2917122:3001769:1 gene:ENSMLUG00000017033 transcript:ENSMLUT00000017037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLEQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLPLEEAVLE
STPQVRQEHKSHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNSVHLGIFFMGIFV
RNRIGRQAVIHRWNDMGNITHNKSTILVELINKEETVLFHTDDIENAKYISRLFATRHKF
YKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCGEHYSETHTSQDSIFHG
NEDAFYCNSHNSLDLNYLNGTITNGSVCSVHSINSLNCSQSFIQASPVSSNLSIPGSDIM
RADYIPSHRHSAIIVPSYRPTPDYDTVMRQMKRGVVHTDSQSQSLRNLNILNTHAYNQPE
DLVYSQPEMRERHPYTVPYGPQGGYGSKLVGPSDQINPKNNSVPSKPGASAISHTVSTPE
LANMQLQGTHSYNTAHMLKNHLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTRK
VQLSVKTFQEDSAPVVHQSLQEVSEPLTATKHHGTVNKRHSLEVMSSMVRGMEAMTLKSL
NIPMARRNTLREQGPPKEVPGGHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEPAAPAP
RIPGLRENMEYSAQLQAALARIPKKPPPEYPGPRKSVSNGALRQDQVSVPPAIARARVLR
HGPAKAVSVSRADQLAVNGSSLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSIIE
REMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREDGRVDGTRILMDERFRTLKK
KLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNTGY
INASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGANVIAMVTAEEEGGRTKSHRY
WPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPDHGC
PEDVQGFLSYLEEIQSVRRHTNSMLEGTQSRHPPIVVHCTAGVGRTGVVILSELMIYCLE
HNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences G1PVY4
ENSMLUP00000015532 ENSMLUP00000015532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]