SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015550 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015550
Domain Number 1 Region: 126-250
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-25
Family Pleckstrin-homology domain (PH domain) 0.0000282
Further Details:      
 
Domain Number 2 Region: 829-887,960-1030,1101-1152,1342-1533
Classification Level Classification E-value
Superfamily ARM repeat 0.0000106
Family HEAT repeat 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015550   Gene: ENSMLUG00000017040   Transcript: ENSMLUT00000017056
Sequence length 2044
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:18041021:18186004:-1 gene:ENSMLUG00000017040 transcript:ENSMLUT00000017056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIKEKTKVVEPLDYENVILQRKTQIYSDPLRDLLMFPMEDISISVISRQRRTVQSTVPED
AEKRAQSLFVKECIKTYSTDWHVVNYKYEDFSGDFRMLPCKSMRPEKIPNHVFEIDEDCE
KDEDSSSLCSQKGGVIKQGWLYKANVNSTITVTMKVFKRRYFYLTQLPDGSYILNSCKDE
KNSKEPKTSIYLDACIEVVQCPKMRRHAFELKMLDKYSHYLAAETEQEMEEWLITLKKII
QINTDSLVQEKKETVEAAQDDETSSQGKAESIMASLERSMHPELMKYGRETEQLNKLSRG
DGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTFNILGQVGDNVKGPPT
NVEPFFINLALFDVKNNCKISADFHIDLNPPSVREMLWGTSTQLTSDGNAKSSSPESFIH
GIAESQLRYVKQGIFSVTIPHPEILLVARIEKVLQGNIAHCAEPYIKNSDPAKTAQKVHR
TAKQVCSRLGQYRMPFAWAARPIFKDAQGSLDLDGRFSPLYKQDSSKLSNEDILKLLSEY
KKPEKTKLQIIPGQLNITVECVPVDLSNCITSSYVPLKPFEKNCQNITVEVEEFVPEMTK
YCYPFTIYKNHLYVYPLQLKYDSQKTFAKARNIAVCVEFRDSDESDAKALKCIYGKPAGS
VFTTNAYAVVSHHNQNPEFYDEIKIELPIHLHQKHHLLFTFYHVSCEINTKGTTKKQDTV
ETSVGFAWVPLLKDGRIITVEQQLPVSANLPPGYLNLNDAESRRQSNVDIKWVDGAKPLL
KIKSHLESTIYSQDLHVHKFFHHCQLIQSGSKEVPGELIKYLKCLHVMEIPVMIQFLPVI
LMQLFRVLTNMTHEDDVPINCTMVLLHIVSQCHEEGLDNYLRSFIKYSFRPEKPSAPQTQ
LTHEILATTMIAILKQSADFLAINKLLKYSWFFFEIIAKSMATYLLEENKIKLPRGQRFP
EAYHHVLHSLLLAIIPHVTIRYAEIPDESRNVNYSLASFLKRCLTLMDRGFIFNLINDYI
SGFSPKDPKVLAEYKFEFLQTICNHEHYIPLNLPMAFAKPKLQRVQDSNLEYSLSDEYCK
HHFLVGLLLRETSIALQDNYEIRYTAISVIKNLLIKHAFDTRYQHKNQQAKIAQLYLPFV
GLLLENIQRLAGRDTLYSCAAMPNSASRDEFAYGFTSPTNRGSLSTDKDTAYGSFQNGHG
LKREDSRGSLIPEGATGFPDQGSTGENTRQSSTRSSVSSQYNRLDQYEIRSLLMCYLYIV
KMISEDTLLTYWNKVSPQELINILILLEVCLFHFRYMGKRNIARIQDAWLTKHFGVDRKS
QTMPALRNRSGVMQARLQHLSSLESSFTLNHSSTTTEADIFHQALLEGNTATEVSLTVLD
TISFFTQCFKSQLLNNDGHNPLMKKVFDIHLAFLKNGQSEVSLKHVFASLRAFISKFPSA
FFKGRVNMCAAFCYEVLKCCTSKISSTRNEASALLYLLMRNNFEYTKRKTFLRTHLQIII
AVSQLIADVALSGGSRFQESLFIINNFANSDRPMKATAFPTEVKDLTKRIRTVLMATAQM
KEHEKDPEMLIDLQYSLAKSYASTPELRKTWLDSMAKIHVKNGDFSEAAMCYVHVAALVA
EFLHRKKLFPNGCSAFKKITPNIDEEGAMKEDAGMMDVHYTEEVLLELLEQCVDGLWKAE
RYEVISEISKLIIPIYEKRREFEKLTQVYRTLHGAYTKILEVMHTKKRLLGTFFRVAFYG
QSFFEEEDGKEYIYKEPKLTGLSEISLRLVKLYGEKFGTENVKIIQDSDKVNAKELDPKY
AHIQVTYVKPYFDDKELTERKTEFERNHNINKFVFEAPYTLSGKKQGCIEEQCKRRTILT
TSNSFPYVKKRIPINYEQQINLKPIDVATDEIKDKTAELQKLCSSADVDMIQLQLKLQGC
VSVQVNAGPLAYARAFLNDSQASKYPSKKVSELKDMFRKFIQACSIALELNERLIKEDQI
EYHEGLKSNFREMVKELSDIIHEQIIQEDTMHSPWMNDTLHVFCAISGTSSDRGYGSPRY
AAEI
Download sequence
Identical sequences G1PW00
ENSMLUP00000015550 ENSMLUP00000015550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]