SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015560 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000015560
Domain Number - Region: 222-360,390-398
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0418
Family FCH domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015560   Gene: ENSMLUG00000017061   Transcript: ENSMLUT00000017066
Sequence length 409
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429779:4986678:5003574:-1 gene:ENSMLUG00000017061 transcript:ENSMLUT00000017066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGESTSAVLSGFVLGALSFQHLNTDSDSEGFLLGEVKGEAKNSITDSQMDDVEVIYTID
IQKYIPCYQLFSFYNSSGELNEQALKKILSSIKKDVVGWYKFRRHSDQIMTFRERLLHKN
LQQHLSSRELVFLLLTPSIITESCSTHRLEHALYKPQKGLFHRIPLVVANLGMSEQLGYK
TVSGSCTSTGFSRAVKTHSPEFFKEDGSLKEVHKINEMYASLQEELKSICKQVEESEEAV
EKLLKDVNRLKQEIKKRKQAQIQAAREKNVQKDPQENIILCQALRTFFPDCEFLHSCVIS
LKNRHISKSSCNTNHQLNVVDNLTLMVEYTDIPEASPASIARQEMKRKALDTDDRRQFKK
SRLLEIQSQPSKTDTDSSNQEKSSTSSPETDEEIEKMKDSGDYPRSPTF
Download sequence
Identical sequences G1PW09
ENSMLUP00000015560 XP_006084628.1.53796 ENSMLUP00000015560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]