SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015600 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015600
Domain Number 1 Region: 64-192
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-23
Family Pleckstrin-homology domain (PH domain) 0.0000475
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015600
Domain Number - Region: 777-880,1223-1280,1314-1426,1896-1942
Classification Level Classification E-value
Superfamily ARM repeat 0.00906
Family MIF4G domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015600   Gene: ENSMLUG00000017096   Transcript: ENSMLUT00000017109
Sequence length 1988
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:22593477:22681977:-1 gene:ENSMLUG00000017096 transcript:ENSMLUT00000017109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFFLKACKFYSSQWYVVNYKYEQYSGDIRQLPGAEYKPEKLPSHSFEVDHEDADKDEDTT
SHSSSKGGGGAGGTGVFKSGWLYKGNFNSTVNNTITVRSFKKRYFQLTQLPDSSYIMNFY
KDEKISKEPKGCIFLDSCTGVVQNNRLRKYAFELKMNDLTYFVLAAETESDMDEWIHTLN
RILQISPEGPLQGKEKGAKERITPQLKIENNGSNLVLKCHRLEKETEETVKATRNLERLN
LFSMDPDIEKKNLLEPESVIKPFEEKAAKRIMIICKALNFSLQGCVTENENDPITNVEPF
FVSVALYDLRDSRKISADFHVDLNHSAVRQMLSGASVTLENGNIDTVTPRQLEEPHVKGF
PEEWLKFPKQAIFSVSNPHSDIVLVAKVEKVLMGNIASGAEPYIKNPDSNKCAQKILKSN
RQFCSKLGKYRMPFAWAMRSVFKDNQGNVDRDSRFSPLYRQESSKISTEDLLKLVSDYRR
ADRISKMQTIPGSLDIAVDNIPLEHPNCVTSSFIPVKPFNVMAQPEPTVEVEEFVYDSTK
YCRPYRVYKNQMYIYPKHLKYDSQKCFNKARNITVCIEFKNSDEEGAKPVKCIYGKPGGP
LFTSAAYTAVLHHSQNPDFSDEVKIELPTQLHEKHHILFSFYHVTCDINAKANAKKKEAL
ETSVGYAWLPLMKHDQIASQEYNIPIATSLPPNYLRFQDSASGKQGGSDMKWVDGGKPLF
KVSTFVVSTVNTQDPYVNAFFRECQKREKAKMAAGSHALKRSNLLNVEKIHAIMSFLPII
LNQLFKVLVQNEEDEISTTVTRVLTDIVAKCHEEQLDYAVQSYIKFVFKTRACKERTIHE
ELAKNVTGLLKSNDSTTIKHVLKHSWFFFAIILKSMAQHLIDTNKIQLSRAERFPESYQN
ELDNLVMVLADHMIWKYKDALEETRRANHSIARFLKRCFTFMDRGFVFKMVNNYISMFSS
GELKTLCQYKFDFLQEVCQHEHFIPLCLPIRSANIPGNNSQGFHRLLQSEHFCLFVHCFP
VSSILVLFEVVTWIKLHGGKVILCEYKFISNYQLRCVIIPILGQYILIFQYILHNINEHN
IYLINPDPLTPSESTQELHASVPAISLAYIINKIPAIYNSIRVQSIFSRLKLLEAYKLNI
MHIPMVHYTVSDSCIISLPAIKSIKHRSDWATDLKALSDLSSTANGIATEVQIAEKHKCQ
LANLYLSFPSTSPNVAHILILITLLLGTVFTVPNICVPHIPTFTTRIICISIHTISPYLS
ECSSLIILISVARLCLNYEKLDVLNKVDTKQNEYIKKVLQVKAQHVLLSGNITQISYISQ
ALQVSMMMLNLQRQLQQSECQNSLMKRVFDTYMLFFQVNQSATALKHVFASLRLFVCKFP
SAFFQGPADLCGSFCYEVLKCCNHRSRSTQTEASALLYFFMRKNFEFNKQKSIVRSHLQL
IKAVSQLIADAGIGGSRFQHSLAITNNFANGDKQMKNSNFPAEVKDLTKRIRTVLMATAQ
MKEHEKDPEMLVDLQYSLANSYASTPELRRTWLESMAKIHARNGDLSEAAMCYIHIAALI
AEYLKRKGMFSMGWPAFLSITPNIKEEGAMKEDSGMQDTPYNEELQHVLVEQLYMCVEFL
WKSERYELIADVNKPIIAVFEKQRDFKKLSDLYYDIHRSYLKVAEVVNSEKRLFGRYYRV
AFYGQGFFEEEEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNVKIIQDSNKVNPKDL
DPKYAYIQVTYVTPFFEEKEIEDRKTDFEMHHNINRFVFETPFTLSGKKHGGVEEQCKRR
TILTTSHLFPYVKKRIQVISQSSTELNPIEVAIDEMSKKVSELNQLCTMEEVDMIRLQLK
LQGSVSVKVNAGPMAYARAFLEETKAKKYPDNQVKLLKEIFRQFADACGQALDVNERLIK
EDQLEYQEELRSHYKDMLSELSVIMNEQTCPLPHPQSPLPQSRDQFLSLNGLAPSTLFRK
HKMNPILL
Download sequence
Identical sequences G1PW42
ENSMLUP00000015600 ENSMLUP00000015600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]