SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015604 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015604
Domain Number 1 Region: 27-331
Classification Level Classification E-value
Superfamily Ferritin-like 2.66e-117
Family Ribonucleotide reductase-like 0.000000000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015604   Gene: ENSMLUG00000017110   Transcript: ENSMLUT00000017113
Sequence length 350
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429881:3761308:3788627:1 gene:ENSMLUG00000017110 transcript:ENSMLUT00000017113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPERPEVAGPELEERLSSDTNENEAKSSEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQ
ASFWTAEEVDLSKDLPHWHKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEA
RCFYGFQILIENVHSEMYSLLIDTYIREPKKREFLFNAIETMPYVKKKADWLRWIADRKS
TFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFRY
LVNKPSEKRVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLVELGFSK
IFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAENRDNVFTLDADF
Download sequence
Identical sequences G1PW45
ENSMLUP00000015604 ENSMLUP00000015604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]