SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015663 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015663
Domain Number 1 Region: 234-408
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.51e-25
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 519-630
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-16
Family Second domain of FERM 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015663
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0641
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015663   Gene: ENSMLUG00000017177   Transcript: ENSMLUT00000017181
Sequence length 736
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429782:1706166:1736601:-1 gene:ENSMLUG00000017177 transcript:ENSMLUT00000017181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPENIEDAYVAVIRPKNTASLNSREYKAKSYEILLHEVPIEGQKKKRKKVLLETKLQS
NSEITQGILDYVVETTKPISPANQGIRGKRVVLLKKFPLDGEKMGREAALFIVPSVVKDN
TKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERPWVDDFPLHRSACEGD
SELLTRLLNEKFSVNQLDNDHWAPIHYACWLGKVEATRILLEKGKCNPNLLNGHLSSPLH
FAAGGGHAEIVQILLNHPEIDRHITDQQGKSPLNICEENKQTNWEETAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKKIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNR
ILHEYKNLSTSEGISKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLKYGCFMWQLGDAGTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPTERNS
Download sequence
Identical sequences G1PWA1
XP_006085007.1.53796 XP_006085008.1.53796 XP_014307872.1.53796 ENSMLUP00000015663 ENSMLUP00000015663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]