SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015685 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015685
Domain Number 1 Region: 160-502
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.13e-118
Family Mammalian PLC 0.000000124
Further Details:      
 
Domain Number 2 Region: 7-159
Classification Level Classification E-value
Superfamily EF-hand 5.34e-38
Family EF-hand modules in multidomain proteins 0.0028
Further Details:      
 
Domain Number 3 Region: 520-646
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.54e-28
Family PLC-like (P variant) 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015685   Gene: ENSMLUG00000017203   Transcript: ENSMLUT00000017207
Sequence length 647
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429777:16010528:16052588:-1 gene:ENSMLUG00000017203 transcript:ENSMLUT00000017207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTSFFVFHTWFLSIVREDFRGGKINLEKALKLLEKFNIQCNYTHVKYIFKDNDRLKQGRI
TIEEFRSIYRNIVHREEIMEIFNAYAENRKFLFEKNLDDFLTREQYIFNMSKSIASEIIQ
KYEPIEEVKQASQMSFEGFSRFLCSSECLLFSKEFNNVYQDMHHPLSDYFISSSHNTYLI
SDQLVGPSDIWGYFASALVKGCRCLEIDCWDGSQNEPVVYHGYTLTSKLLFKTVIQAIHK
YAFITSDYPVVLSLENHCSPPQQEVIADILHSVLGDALLSDILDDFLDKLPSPEALKFKI
LVRNKKIGTLIETHSRKGLDKHGKIGEFEEYEDIDQEEEVHKAKSSRLLITLTDSPEKET
ESKTSAGLAFFRKKKTLKVKVALALSDLVIYTKAEKFRDFNYSREYQKFYESNSIEESTA
RKLSKLKAHDFILHTTKFITRIYPKALRADSSNFNPQEFWNIGCQMVALNFQTPGMPMDI
QNGKFLDNGGSGYILKPRFLRDTETEFNPQKTPEDSKPVTLTIKVISGIQLPPSIHSSSN
KADTLVIIEIFGVPNDQVKQQTHVVKKNAFSPRWNETFTFIIQVPELALIRFVVESQNII
AENEFLGQYTLPLLCMGKAGYRRVPLFSKSGEDLEPASLFVYVWYIR
Download sequence
Identical sequences G1PWC0
ENSMLUP00000015685 ENSMLUP00000015685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]