SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015689 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015689
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-19
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015689   Gene: ENSMLUG00000017206   Transcript: ENSMLUT00000017212
Sequence length 557
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430064:226449:230018:1 gene:ENSMLUG00000017206 transcript:ENSMLUT00000017212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHSHQAQLARALYDNTAESPQELSFRQGDVLRVLQREGAGGLDGWCLCSLHGQQGIVPAN
RVKLLPDGPAPKPSLSQVPPAEPGSPYPAPEHSNEDQEVYVVPPPARPCLTSGSPTGLCL
PSPDPIYKVPRGTGTQLAAPGGVLEVYDVPSSALRVPSSDPYDSPASFSRPLARVTPQPP
GEDEAPYDVPLAPKSPSELEPDVEWEEGREPGPPLYAAPSNLKRASALLNLYEAPEELLA
DGEGGTEEGIYDMPLLGPEAPPEPPGASASNDPDTLALLLARSPPPSHRPRLPSAESLSR
RPLPALPVPEAPSPSPAPSPAPGRKGSIQDRPLPPPPPRLPGYGGPKVEGDSEGQEAEDS
SAGHHNEYEGIPVAEEYDYVHLKGMDKAQGSRPLDKAFPGDPEVLERGPPEQQEVLSPGE
HLVLPAGDLQLLHFYAGQCQNHYSALQAAVAALMSSSRAHQPPRLFVPHGKQVVVAAHRL
VFVGDTLGRLATSAPLRAQVGAAGTALGQALQATVLAVKGAALGYPSGSAAQEMAQCVTQ
LAGQALQFTNLLTSLAP
Download sequence
Identical sequences G1PWC3
ENSMLUP00000015689 ENSMLUP00000015689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]