SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015752 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015752
Domain Number 1 Region: 120-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.93e-70
Family Arfaptin, Rac-binding fragment 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015752   Gene: ENSMLUG00000017276   Transcript: ENSMLUT00000017281
Sequence length 341
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430462:156820:161634:-1 gene:ENSMLUG00000017276 transcript:ENSMLUT00000017281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGILGKAATMEIPIHGNGEAGQLPEDDGLEQDLQQVMVSGPNLNETSVVSGGYGGSGD
GLIPTGSGRHPSHSATPASPGDEVARGIAGEKFDIVKKWGINTYKCTKQLISERFGRGSR
TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
Download sequence
Identical sequences G1PWI0 S7NRE4
XP_005886306.1.60319 XP_006105620.1.53796 XP_014303185.1.53796 XP_014388822.1.60319 ENSMLUP00000015752 ENSMLUP00000015752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]