SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015785 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015785
Domain Number 1 Region: 19-262
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.32e-30
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 331-378
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000497
Family SOCS box-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015785   Gene: ENSMLUG00000017313   Transcript: ENSMLUT00000017316
Sequence length 386
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430372:6716:9562:-1 gene:ENSMLUG00000017313 transcript:ENSMLUT00000017316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPRPGYVPSEESRLLVLTELLERKAHSPFYQEGVSNALLKMAELGLTQAADVLLRNGANL
NFEDPVTYYTALHIAVLRNQPDMVELLVRHGADINRRDRIHESSPLDLASEEPERLPCLQ
RLLDLGADVNAADKHGKTALLHALASSDGVQIHNTENIRLLLEGGADVKATTKDGDTVFT
CIIFLLGETVGGDKEEAQMINRFCFQVTQLLLAHGADPSECPAHESLTHFCLKSFQVHFP
LLRFLLESGAAYNCSLHGASCWSGFHVVFDRLCSHPGCAEDESHVDLLRKAETVLDLMVT
NSPKLQLPGNFDIHPVGSLAEKIRALHSSLRQLESHPPPLKHLCRVHIRHYLQPWPVDAK
VQALPLPDRLKWYLLSEHSSPVEADI
Download sequence
Identical sequences G1PWK4
ENSMLUP00000015785 ENSMLUP00000015785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]