SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015836 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015836
Domain Number 1 Region: 11-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.88e-57
Family FCH domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015836
Domain Number - Region: 659-794
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.000484
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015836   Gene: ENSMLUG00000017366   Transcript: ENSMLUT00000017371
Sequence length 814
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:40440943:40538439:-1 gene:ENSMLUG00000017366 transcript:ENSMLUT00000017371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLMAHINEQQWGEKNSGFDILYHNMKHGQISTKELADFVRERATIEEAYFRSMTKLAKSA
SNYSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVA
GTLEAVQTIQSITQALQKSKENYNAKCVEQERLKKEGATQREIEKAAVKSKKATDTYKLY
VEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAVKEIHLQIGQVHEEFIN
NMANTTVESLIQKFAESKGTGKERPGLIEFEECDPASAVEGIKPRKRKTFGLPGIIKKEK
DAESVECPDADSLNIPDVDEEGYSIKPEANQNDIYSHTKENHFYSSSDSDSEDEEPKKYR
IEIKPMHPNNSHHTMASLDELKVSIGNITLSPAISRHSPVQMNRNSSSEELTKSKSSASS
NEKGTSDLLAWDPLFGGLSLDSSSASLTSSSSARPTTPLSVGTIVPPPRPASRPKLTSGK
LSGINEIPRPFSPPVTSNTSPPPAAPLARAESSSSISSSASLSAANTPTVGVSRGPSPVS
LGNQDTLPVAVALTESVNAYFKGADPTKCIVKITGDMTISFPSGIIKVFTSNPSPAVLCF
RVKNISRLEQILPNAQLVFSDPSQCDSNTKDFWMNMQAVTVYLKKLSEQNPAASYYNVDV
LKYQVSSNGIQSTPLNLATYWKCSAGTTDLRVDYKYNPEAMVIPSVLSNIQVMVPVDGGV
TNMQSLPPAIWNAEQMKAFWKLSGVSEKSENGGSGTLRAKFDLSEGPSKPTTLAVQFLSE
GSTLSGVDIELVGTGYRLSLVKKRFATGRYLADC
Download sequence
Identical sequences G1PWP9
ENSMLUP00000015836 ENSMLUP00000015836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]