SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015860 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015860
Domain Number 1 Region: 390-715
Classification Level Classification E-value
Superfamily DNase I-like 2.64e-56
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000837
Further Details:      
 
Domain Number 2 Region: 6-104
Classification Level Classification E-value
Superfamily SH2 domain 7.54e-27
Family SH2 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015860   Gene: ENSMLUG00000017391   Transcript: ENSMLUT00000017395
Sequence length 1194
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:28127444:28219844:1 gene:ENSMLUG00000017391 transcript:ENSMLUT00000017395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPWSPCWNHGNITRSKAEELLRTGKDGSFLVRASESIPRAYALCVLYRNCVYTYRILPN
EDDKFTVQASEGVPMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDEPEEETGG
VEGVPAPPELPPRNIPLSAGPCEAKEVPLLSENLRATEVSRPSLPETLFQRLQSMDTSGL
PEEHLKAIQDYLSTQLTLDADFVKTGSSSLPHLRKLTVLLCKELYGEVTRTLPSLESLQR
LFDQQLSPGLRPRPQVPGEANLINMVTKLSQLTSLLSSIEDKVKALLHEGPESSHRRSLI
PPVTFEVKSESLALPQKLQLKVDVETGKLIIKKSKDGSEDKFYSHKKILQLIKSQKFLNK
LVILVETEKEKTVRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNA
PPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPGEKEWLEILKNSLQEITSITF
KMIAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGF
VNSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWLGDLNYRVELPTW
EAEPMIQKIKQQQYAELLCHDQLLMERKEQKVFLHFEEEEITFAPTYRFERMTRDKYAYT
KQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFV
SKNGPGTVDSQGQIEFLRCFATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELV
VKFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPL
THHGEMTGHFRGEIKLQTSQGKMREKLYDFVKTERDESSGPKCLKSLTSHDPMKQWEPAS
RVPLCSGSSVTEIINPNYMGVGSFGYIKQNLSPDQQPTAWSYDQPLKDSSLGSGRGETPP
TPPSQPPISPKKFSSSIATRGPCPRTQESRPSDLGKNAVEPLPQEDPKLTKPEMFENPLY
GSVCAFSKLVPRKEQESPKMLKKELPPCPDPGSLSPNILLSKAQEPEGNKGTGKPVPIPA
PTPFISPAPRLRSFTCSSPAEGRPAAGDKSQGKPKAPASSPAPVPAKRPIKPSRSELSQQ
APPTPAQRPPLPLKSPAVLHLQHSKGRDYRENAELPHHGKHRPDDTPLSRTAMQ
Download sequence
Identical sequences G1PWS1
ENSMLUP00000015860 ENSMLUP00000015860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]