SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015871 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015871
Domain Number 1 Region: 461-518
Classification Level Classification E-value
Superfamily UBA-like 3.44e-19
Family CUE domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015871   Gene: ENSMLUG00000017403   Transcript: ENSMLUT00000017407
Sequence length 750
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430036:231210:256063:1 gene:ENSMLUG00000017403 transcript:ENSMLUT00000017407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALPLDQLQITHKDLKTGKLRTSPALHPEQKADRYFVLYKPPPKDNIPALVEEYLERAT
FVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLHYVPRKFDEWVAPAPEVAAMQKRLH
RSVFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLKKMI
GNIFNQQPSYYNDLDESMPTILQVFSNILQHSGLQGDGASSTPQKLEERGRLTPSEMPLP
ELKDIVLYLCDTCTTLWAFLDIFPSACQTFQKHDFCYRLASFYEIAIPELESAIKKRRLE
DSRLLGDLWQRLSHSRKKLLEVFHILLYQICLLPILESSCDNIQGFIEEFLQIFSSLLQE
KRFLRDYDALFPVADDVSLLQQASSVLDETRAAYILQAVESAWEGVDRRKPTDAKDPPVA
EDLNGVGATAEPVSGPASHPENSEEEECLGAAAALGPPVSGVELDSLISQVKDLLPDLGE
GFILACLEHYGYDPEQVINDILEERLAPALSQLDRGLDREIKPDPTPLLASRHNVFQNDE
FDVFSRDSVDLSRVHKGRRKEENARSLLNDKREVAAQRQRYEQYRVVVEEVPLQPGEGLS
YRGDDYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPTEGQEEDDEEEEE
AEDEAPKPDHFVQDPAVLREKAEARRMAFLARKGYRHDSSAAVAGSPRGHGQNRETTQER
RKKEANKSTRANHNRRTMADRKRNKGMIPS
Download sequence
Identical sequences G1PWT1
ENSMLUP00000015871 ENSMLUP00000015871 XP_014320306.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]